KEGG   Lactococcus lactis subsp. lactis Il1403: L162872Help
Entry
L162872           CDS       T00045                                 

Gene name
dfrA
Definition
(RefSeq) dihydropholate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
lla00670  One carbon pool by folate
lla00790  Folate biosynthesis
lla01100  Metabolic pathways
Module
lla_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    L162872 (dfrA)
   00670 One carbon pool by folate
    L162872 (dfrA)
Enzymes [BR:lla01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     L162872 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 1114791
NCBI-ProteinID: NP_267306
UniProt: Q59487
Position
1163134..1163640
Genome map
AA seq 168 aa AA seqDB search
MIIGIWAEDEAGLIGEADKMPWSLPAEQQHFKETTMNQVILMGRKTFEGMNKRVLPGRIS
IILTRDETYQSDNEKVLIMHSPKEVLDWYHKQNKDLFITGGAEILALFESELELLYRTVV
HEKFKGDTYFPSTFDFGRFKLVSEKFHDKDERNSYTFTIKKYEKVKQP
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgataattggaatatgggcagaagatgaagcaggtcttatcggtgaagctgataaaatg
ccttggtctttacctgctgaacaacaacattttaaagaaacaaccatgaatcaagtgatt
ttgatgggacgaaaaacgtttgaaggcatgaataaacgtgtattgccagggagaataagt
attattttaactcgcgatgaaacttatcaatcagataatgaaaaagtgctcatcatgcac
agccctaaggaagttctagattggtaccataagcaaaataaagacttatttatcacagga
ggagctgaaattttagccctttttgaatctgaacttgaattgctctatcgaacagttgtt
catgaaaaatttaaaggagatacttattttccaagtacatttgactttggaagatttaag
ctagtctctgaaaaatttcacgataaagatgagcggaattcttatacttttacaattaaa
aaatatgaaaaagtgaaacaaccatga

DBGET integrated database retrieval system