KEGG   Lactococcus lactis subsp. lactis Il1403: L176238Help
Entry
L176238           CDS       T00045                                 

Gene name
yfhH
Definition
hypothetical protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Brite
Enzymes [BR:lla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     L176238 (yfhH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
576304..577077
Genome map
AA seq 257 aa AA seqDB search
MNYIAVLVTLLLYFICWFLIATSKKNYGLIDIAWGGGFVLTAVVSYLFSPRITIQNSLIL
VLVILWGVRLAIHLGRRNWNKPEDYRYTNMRKRWGNNFPKLKAFLTVFMVQYLLLIIISL
PIIQVNSNVNSQFYWWQILGIIIWIFGFIFEVFGDRQLEVFKKLPQNKGKLLTSGLWSLT
RHPNYFGESMCWWGIFLISLTTLSTLWLVISPLLITSLLLFVSGVPILEKKYKNREDFKE
YAKTTPKFVPFIGKKGL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaattatatagccgttttggtaactttattactttatttcatctgttggtttcttatt
gcgacatctaagaagaattacggattgatagatattgcttggggcggaggatttgttctt
acagctgtggtctcttatttattttctccgagaattacgattcaaaatagcctaatctta
gtattagtcatattatggggagtacgtttagcaattcatttaggaagacgaaattggaat
aaacccgaggattatcgctatacaaatatgcgtaagaggtggggcaataattttccaaaa
ttgaaagcttttctaacggtatttatggtgcaatatcttttgttaatcattatttcactc
ccaattattcaagtcaattcaaatgttaattctcaattttattggtggcaaattttaggt
ataataatttggatatttggctttatctttgaagtttttggagatcgtcagttagaagtc
tttaaaaaactaccccaaaataaaggaaaactattgactagtggcctgtggtcactaaca
cgacatcctaattattttggcgagtcaatgtgttggtggggaatattcttaatctctttg
acgactttatcaacgctttggttggttattagtccactattgattactagtctcctttta
tttgtatctggtgtaccaattcttgaaaaaaaatataagaatcgtgaagattttaaagaa
tatgcaaaaactaccccgaagtttgttccttttattggtaaaaagggcttgtag

DBGET integrated database retrieval system