KEGG   Lactococcus lactis subsp. lactis Il1403: L177590Help
Entry
L177590           CDS       T00045                                 

Gene name
hasC
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lla00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    L177590 (hasC)
   00052 Galactose metabolism
    L177590 (hasC)
   00500 Starch and sucrose metabolism
    L177590 (hasC)
   00520 Amino sugar and nucleotide sugar metabolism
    L177590 (hasC)
Enzymes [BR:lla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     L177590 (hasC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
1377854..1378795
Genome map
AA seq 313 aa AA seqDB search
MKQNIIPTKARKVRKAVIPAAGLGTRFLPATKAIAKEMLPIVDKPTIQFIVEEALKSGIE
DILIVTGKAKRPIEDHFDSNIELEQNLLEKGKTELLKLVEETTDINLHFIRQSHPKGLGH
AVLQAKAFVGNEPFVVMLGDDLMNITGNETPLTKDLINDYEKTHASTIAVMKVPHDDVDK
YGVIDPNGEVSKGLYNVERFVEKPNVDEAPSDLAIIGRYLLTPEIFDVLETQVPGAGNEI
QLTDAIERLNKTQRVFAHEFTGKRYDVGDKLGFVETTIEYGLEHPQIGANLKNYIIEKAK
ELSQDDSKNITKK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaacattattccaactaaagcccgaaaagtacgtaaagctgttattcctgcc
gctggtctcggaactcgctttttgccagcaactaaagcgattgccaaagaaatgttgcca
atcgtcgacaaacctactattcaatttatcgttgaagaagccttgaaatcaggaatcgaa
gatattttgattgttactggtaaagcaaaacgtcctattgaagaccattttgactcaaac
attgagcttgaacaaaatttgcttgaaaaaggaaaaacagaattacttaaacttgttgaa
gaaacgacagatattaatcttcactttatccgtcaatctcatccaaaaggattgggacat
gccgttcttcaagctaaagcttttgttggaaatgagccttttgtagtcatgcttggcgat
gacttgatgaatattactgggaatgaaactcctttaactaaagacctaatcaatgattat
gaaaaaactcacgcttcaacaatcgcggttatgaaagttcctcatgatgatgttgataaa
tatggtgtcattgaccctaacggtgaagtttctaaaggcctttacaatgttgaacgtttt
gtcgaaaaaccaaatgttgatgaagctccttctgaccttgcaattatcggtcgttacctc
ttaactcctgaaatttttgatgttttagaaacacaagttcccggtgcaggaaatgaaatc
caattgactgatgctatcgaacgtttgaataaaacacaacgcgtttttgctcatgaattt
actggaaaacgttatgatgttggtgataaacttggttttgttgaaacaacaattgaatat
ggtttagaacacccacaaatcggtgcgaatttgaaaaactacatcattgaaaaagcaaaa
gagctttctcaagatgactcaaaaaatatcactaaaaaataa

DBGET integrated database retrieval system