KEGG   Lactococcus lactis subsp. lactis Il1403: L190278Help
Entry
L190278           CDS       T00045                                 

Gene name
ypjA
Definition
dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lla00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    L190278 (ypjA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    L190278 (ypjA)
  Lipid metabolism
   00071 Fatty acid degradation
    L190278 (ypjA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    L190278 (ypjA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    L190278 (ypjA)
   00626 Naphthalene degradation
    L190278 (ypjA)
Enzymes [BR:lla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     L190278 (ypjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
complement(1590528..1591574)
Genome map
AA seq 348 aa AA seqDB search
MKSVYFVEKNKMQVREFPKAQLVKETDAIIKIVRACVCGSDLWWFRGISERQPGPVGHEA
IGLIEEVGTGVKNFKVGDFVIVPFTHGCGHCPICLAGFEANCPNAKDGVNGGYQGEFYRA
INTDGALVKIPGQPSDYSDDQLASLTALADVMPTGFHAAKAADVHEGDTVVVFGDGAVGL
CAVISAKLLGAKRIIAMSRHEDRAALARDFGATDIIDERGEEAIQKIMSLTNGYGADAAL
ECVGTKQAIESAFQAVRAGGRVGRVGVPHDVDYNEWIDSLFWKNIQLGGGVASVARWDKE
ILLEAVLSGEINPGRVFTAEFSLDEIQKAYEAMDQRTAIKSLLRISEV
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagtttattttgtcgaaaaaaataaaatgcaagttagagaatttcccaaagcg
caacttgtaaaagaaacagatgctatcataaaaattgttcgtgcctgcgtatgtggttcc
gatttatggtggttccgtgggatttctgaacgtcaacctggaccggtagggcatgaagct
attggtctgattgaagaagtaggcaccggagttaaaaactttaaagtaggagattttgtc
attgttccctttacgcacggttgtggacactgtccaatttgtttggctggctttgaagcc
aattgtccaaatgcaaaagatggtgtgaatggcggctatcaaggagaattctatcgggcg
attaatactgatggtgcacttgtcaaaatcccgggccaaccaagtgattattctgatgac
cagttggcttcattgacggctttagctgatgtcatgcctacaggttttcatgcagctaaa
gcagcagatgtccatgaaggtgatacagtggttgtctttggtgatggagcggttggactt
tgtgcagtgatttcagctaaacttttaggagcaaaacggattattgccatgagtcgccat
gaagaccgtgcagcacttgcgcgtgactttggtgcaacagatattattgatgaacgtggt
gaagaagcgattcaaaaaattatgtccttaaccaatggttatggtgcagatgctgcctta
gaatgtgtcggaacaaaacaagcaattgaatctgcttttcaagcggtaagagcaggaggg
cgagtaggtcgtgtgggagttcctcatgatgttgattacaatgaatggattgattctctt
ttttggaaaaatattcaacttggagggggagtagcctctgtcgcacgctgggataaggaa
atcttacttgaagcagttttaagtggggagattaatccaggccgtgtctttacagcagaa
tttagcttagatgaaattcaaaaagcatatgaagcaatggatcaacgtacagcaattaaa
tctctattgagaatttcagaggtataa

DBGET integrated database retrieval system