KEGG   Lactococcus lactis subsp. lactis Il1403: L25946Help
Entry
L25946            CDS       T00045                                 

Gene name
fadA
Definition
(RefSeq) acetyl coenzyme A acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:lla00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    L25946 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    L25946 (fadA)
   00640 Propanoate metabolism
    L25946 (fadA)
   00650 Butanoate metabolism
    L25946 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    L25946 (fadA)
   00072 Synthesis and degradation of ketone bodies
    L25946 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    L25946 (fadA)
   00310 Lysine degradation
    L25946 (fadA)
   00380 Tryptophan metabolism
    L25946 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    L25946 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    L25946 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    L25946 (fadA)
Enzymes [BR:lla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     L25946 (fadA)
Exosome [BR:lla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   L25946 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1842622..1843770
Genome map
AA seq 382 aa AA seqDB search
MSFKNPVGIIAANRLPIGKINGFYKKISPETLYQNLIKQQFNKNLLLKKADIDYIILGNV
TNQGGNLARRCALKAGFSSQVPAFTIDQQCGSGLTAMISSANYIISGEASVICTGGVEST
SQANIVLDSESYQPINRFKMAPEPYEDFDMGTIADMTALKYNIPRSVQDLYALNSHKKAT
QAIEGKLLENEVFPYQDEGFTISSDQTVRPKSSMEALSKLTPAFTTNGTATAGNSCPIND
GASSIILSSTNNPFDFQGYYLGQTTIALSPSDFLLGPIKATEKLLQKFNLKLNDIEAIEL
NEAFASQAILFQNYFKLDDIKLNAYGGSLAFGHPYGATGGILISRLLNRLNQVQKPCLGI
ATLCVAGGMGISVLIGNQWYQK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaaaaatcccgtcggtatcatagcagcaaaccgtttacctataggaaaaatc
aatggtttttataaaaaaatttctcctgaaactttatatcaaaatctaattaaacaacaa
tttaataaaaatctacttctcaaaaaagctgatattgactatattattttgggaaatgtg
actaatcaaggaggaaatttagctcgacgttgtgccttaaaagcaggattttctagccag
gtcccagcttttacaattgaccagcagtgcggttctggactgacagctatgattagctct
gcaaactacattatttctggtgaagcttccgttatttgtacaggaggggtagaaagcaca
tctcaagccaatattgtgcttgattcagagagttatcagccgattaaccgatttaaaatg
gctcctgaaccctatgaagatttcgacatgggaacaattgccgatatgacagccctaaaa
tacaatattcctcgtagtgttcaagacctttacgctctaaatagtcataaaaaagcgact
caagctattgaaggaaaacttttagaaaatgaagtttttccctatcaagatgaaggattt
acaataagtagcgatcaaactgttcgtcctaaatcctcaatggaagctttgagcaaatta
acccctgcttttaccactaacggaacagccactgctggaaactcttgcccaataaacgat
ggtgcttcttcaatcatattgtcatccactaataatccttttgattttcaaggctattat
ttaggacaaacaactattgctttatctccatcagatttcttattaggcccaataaaagca
actgaaaaacttttacagaaatttaaccttaaacttaatgatattgaggctatcgaatta
aatgaagcctttgccagtcaggccattttattccaaaattattttaagcttgatgatata
aaattaaatgcttatggtggttcccttgcatttggtcatccttacggtgcaactggtggc
attctaatttctcgactcttaaatcgcctaaaccaagtgcaaaaaccatgtcttggcatc
gcaactttgtgcgtagctggaggtatgggaatcagtgtactgataggtaatcaatggtat
caaaaatga

DBGET integrated database retrieval system