KEGG   Lactococcus lactis subsp. lactis IL1403: L32812Help
Entry
L32812            CDS       T00045                                 

Gene name
yidC
Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lla  Lactococcus lactis subsp. lactis IL1403
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lla00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
832872..834233
Genome map
AA seq 453 aa AA seqDB search
MENKMPKDFFWGNSTSSMQTEGGWNEGGKGPSVYDVNTVGRSAKDWQVTNDNYHHYSQDL
DLMKEMNMNMYRFQISWSRIVPDGDGEFNEEGIAFYNRLIDDLLARGIEPMICLYHFDMP
LNLAEKYNGFLSRKVKEAFVRFGQEMMKRFADKVKYWIVFNEHNLYFADGFEHYSGVLKK
ELTLSDMYTVFHHTMLAHCELTQFLHENFEAKIGGMLATTEIYPATFSPKDNLYLRKFDE
FYNRNLCDVYAFGHYSHEVMTYVKNQNIQMDFQKGDEEILKNGISDFISFSYYRSILLDA
SQLTENDAPNSYLTKGMKLNPLLEHNQWDWSIDPEGFRRILSRLYNEFGLPVFPIENGIG
QSEIWDGKTKIADDLRISYHQKHLEAMKKAIFTDGVEVMGYLGWGLIDIPASSGAIDKRY
GAVYVDSKSHKRIPKKSFHWFKNVFASNGDHLD
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaaatgccaaaagattttttctgggggaattcaacttcgtcaatgcaaacc
gaaggcggctggaatgaaggaggaaaagggccctctgtctatgatgtgaataccgttgga
cgttctgccaaagattggcaagtaacaaatgataattatcatcattattcccaagatcta
gatcttatgaaagaaatgaatatgaatatgtatcgtttccaaatttcttggtcacgaatt
gttcctgacggcgatggtgaatttaatgaggaaggaattgccttttataatcgtctgatt
gatgatttgcttgctcgtggaattgagcctatgatatgtctctatcatttcgatatgcca
ttaaatctggctgaaaagtacaatggttttttgagccgaaaagtgaaagaagcatttgta
agatttgggcaagaaatgatgaaaagatttgctgacaaagtcaaatattggattgttttt
aatgagcataatctttattttgctgacggttttgagcattattcgggagttttgaaaaaa
gagctgacactctctgatatgtatactgtttttcatcacaccatgcttgctcattgtgaa
ttgacccaatttttgcatgaaaattttgaagcaaaaataggaggaatgttggcgactacg
gaaatatatcccgcaactttttcaccaaaagataatttatatcttagaaaatttgatgaa
ttttataatcgaaatctctgtgatgtttatgcttttggtcattattcgcatgaggttatg
acctatgttaaaaatcagaacatccaaatggattttcaaaaaggagatgaagaaatttta
aaaaatggaatttctgactttatttctttttcttattatcgctcaattttacttgatgca
agtcagctgacagaaaatgatgcaccaaattcttatttgactaaaggaatgaaattaaat
ccgttgcttgaacataatcaatgggattggtccattgacccagaaggctttagaagaatt
ctaagtagattatataatgaatttggattgcctgtttttcctattgaaaatggcattggt
cagtcagaaatctgggatgggaaaacaaaaattgctgatgacttgagaatttcttatcat
cagaaacatcttgaagccatgaaaaaggcaatatttactgacggggtagaagttatgggt
tatcttggttggggattgattgatattcctgcttcatctggtgctattgataaacgttac
ggtgctgtttatgtggattcaaaaagtcataaacgtattccaaaaaaatcatttcattgg
tttaaaaatgtttttgcttcaaatggtgatcatttggattag

DBGET integrated database retrieval system