KEGG   Lactococcus lactis subsp. lactis Il1403: L54021Help
Entry
L54021            CDS       T00045                                 

Gene name
fbp
Definition
(RefSeq) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
lla00010  Glycolysis / Gluconeogenesis
lla00030  Pentose phosphate pathway
lla00051  Fructose and mannose metabolism
lla00680  Methane metabolism
lla01100  Metabolic pathways
lla01110  Biosynthesis of secondary metabolites
lla01120  Microbial metabolism in diverse environments
lla01130  Biosynthesis of antibiotics
lla01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    L54021 (fbp)
   00030 Pentose phosphate pathway
    L54021 (fbp)
   00051 Fructose and mannose metabolism
    L54021 (fbp)
  Energy metabolism
   00680 Methane metabolism
    L54021 (fbp)
Enzymes [BR:lla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     L54021 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos Metallophos_2 XendoU
Motif
Other DBs
NCBI-GeneID: 1113867
NCBI-ProteinID: NP_266413
UniProt: Q9CIU9
Position
254043..255965
Genome map
AA seq 640 aa AA seqDB search
MDKKYYQLLKNQFSSKEAVLTEIINLSAICELPKATEHFMSDVHGEYDAFNHVLRNGSGS
IKEKLRDCFPEFSATEISSLATLIYYPQEKLDSECQLKETEEFENYCRINLVYLLKTVKF
VGQKYTRSKVRKAFPEKFRYILEELINEVDSTTDKRDYFDSILSQLQNLGEFTRLIVALA
DTIRRLTVDHLHVVGDIYDRGPYPDKIIDRLIKMPSVDVQWGNHDIVWMAAFSGSPLAMM
NVIRICARYGNLDILEESYGINLRMILEYAERYYEPSEAFQPRLVEGVRLSDDEKALLNK
LQEATAILQFKLESQLIKRRPDFQLEHRDVLHFIDFSEKTIKLGTEVYELTDFQAPTVNP
EQPESLTAEEEKIISHLLNNFRSSDKLKRHVEFLQEKGAMYLSYNGNLLIHGCLPLHENG
DFKSFTVNKEAHAGRDLLDFFDQEVRKCLAHPENSTDLATDLMWYLWVGECSSLFGKTAM
TTFERYYIKDKKTHVEKKNPYYQLREEAEIIRKILENFGLDEGGHLVNGHTPIKEKNGEN
PIKADGKLIVIDGGFAKAYQKETGIAGYTILYNSFGIQLVAHQPFSTVKEAVEKGTDIIS
LKCLVAEVDQRKRVKDTNVGQTLLSEIADLEVLFEHYEEF
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaatattatcaattactaaaaaaccagttttcgtcaaaggaagcagtactg
acagaaattattaatttgagtgctatttgtgaactaccaaaagcaacagagcattttatg
agtgatgtgcatggtgaatatgatgcttttaatcatgttttgagaaatggttctggcagt
atcaaagaaaaacttagagattgttttccagaattttctgcgacagaaatatcatcactt
gcaaccttgatttattatccacaagaaaaactagattctgagtgtcaactaaaagagaca
gaagaatttgagaactattgtcgaatcaatttagtttatcttttaaagactgtaaaattt
gtcggtcaaaaatatactcgttcaaaagtccgaaaagcttttccagaaaaatttcgatat
atcttagaagagttaatcaatgaagtggattcgacgactgataaaagagattattttgat
tcaatcctttcgcaattgcaaaatttgggtgaatttactcgcttaattgttgcacttgca
gatacgattcgcagattgacggttgaccaccttcatgtggtgggagatatttatgatcga
ggaccttatccagataaaatcattgaccgcttaataaaaatgccctcagttgatgttcaa
tggggcaatcatgatattgtatggatggcagcttttagtggttcacctttagccatgatg
aatgtaattagaatctgtgcccgctatggaaatctcgatattcttgaagaatcttatggg
attaatttacggatgattttagagtatgctgaacgttattatgagccaagtgaggctttt
caaccacgtttggtcgaaggggttcgtttgtcagacgatgaaaaggcgctccttaataaa
ttacaagaagccacagccattttacaatttaagttagagagtcagttgataaaacgccga
cctgattttcaacttgaacatcgtgatgtccttcatttcattgatttttccgaaaaaaca
ataaaattgggaactgaagtttatgaattaactgattttcaagcgcccacagtaaatcct
gagcagcctgaaagtttgactgctgaagaagaaaaaataatcagtcatttattaaataat
tttagaagttctgataaacttaaacgtcatgttgaatttttacaagaaaagggagctatg
tatctttcttacaatggaaacttgttgattcatggctgtcttcccttacatgaaaatggt
gattttaaatcatttacggttaacaaagaggctcatgctggccgtgatttgcttgatttc
tttgaccaagaggttagaaaatgtcttgctcatccagaaaactcgacggatttagcaaca
gatttgatgtggtatctttgggtgggagaatgctcttcattatttggtaaaacggcaatg
acaacctttgaacgctattatatcaaggataagaaaacgcatgtggaaaagaaaaatcct
tattatcaattgcgtgaggaagctgaaattatcaggaaaattttagaaaactttggttta
gatgaagggggacatttggtgaatgggcacacccctatcaaagaaaaaaatggtgaaaat
ccaatcaaggcagatggaaagttgattgtgatagatggtggttttgcaaaagcttatcaa
aaggaaacaggaattgctgggtatacaattctttataatagttttggcattcaactggtt
gctcatcaacccttttcaaccgttaaagaagcagttgaaaaagggacggatattattagc
ctgaaatgcttggtagccgaagttgaccaaagaaaacgagtcaaggatacaaatgttggc
caaactttgttaagtgaaatagcagatttagaagtactttttgaacattatgaggaattt
taa

DBGET integrated database retrieval system