KEGG   Lactococcus lactis subsp. lactis Il1403: L59867Help
Entry
L59867            CDS       T00045                                 

Gene name
pepV
Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    L59867 (pepV)
  Amino acid metabolism
   00300 Lysine biosynthesis
    L59867 (pepV)
Enzymes [BR:lla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     L59867 (pepV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
859866..861284
Genome map
AA seq 472 aa AA seqDB search
MTTIDFKAEVEKRKDALMEDLFSLLRIDSAMDMEHADAENPFGPGPRKALDAFLKIAERD
GYTTKNYDNYVGHFEYENGASDDAEVLGIIGHLDVVPAGSGWDSNPFEPEIRNGNLYARG
ASDDKGPTVACYYALKILKELNLPLSKKIRFIVGTNEETGWADMDYYFEHCELPLPDFGF
SPDAEFPIINGEKGNITEYLHFVGKNDGEVVLHSFKAGLAENMVPESATAVISGAKDLQA
ALEKFVAEHASKNLRFDLEESAGKATITLYGKSAHGAMPEKGVNGATYLTLFLNQFNFAD
GAAAFIKVGAEKLLEDHEGEKLGTAYVDELMGNTSMNAGVWSFDENSEGKIALNFRFPQG
NSPERMQEILAKLDGVVEVELSKHLHVPHYVPMSDPLVSTLIDVYEKHTGLKGYETIIGG
GTFGRLLERGVAYGAMFEGEPDSMHQANEMKPVENIYKAAVIYAEAIYELTK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgacaactattgattttaaagccgaagttgaaaagcgtaaagacgctttgatggaagat
ttatttagccttttgcgcattgattctgcaatggatatggaacatgcagatgctgaaaat
ccatttggtcctggtccaagaaaagcattggatgcattcttgaagattgctgaacgtgat
ggttatacaacaaaaaattatgataattatgttggacattttgaatacgaaaatggtgca
agtgatgatgcagaagttcttggaattatcggtcacttagacgttgttcctgcaggttct
ggttgggattcaaatccatttgaaccagaaattcgtaatggaaatctttatgctcgtgga
gcatctgatgataaaggtccaactgttgcatgttactatgctcttaaaatcttgaaagaa
ctcaatcttccattaagcaaaaaaatccgttttatcgttggaacaaacgaagaaactggt
tgggcagatatggattactattttgaacattgtgaattgccattgcctgactttggtttc
tcacctgatgctgaattcccaattatcaatggtgaaaaaggaaatattacagaatatctc
cattttgtaggcaaaaatgatggagaagttgttcttcacagctttaaagctggtcttgcc
gaaaatatggttccagaatctgcaactgcagtaatttcaggtgctaaagatttacaagct
gcacttgaaaaattcgtagctgaacatgcaagcaaaaatcttcgttttgaccttgaagaa
agtgctggaaaagcgacaattacactttatggtaaatcagcacatggtgcgatgccagaa
aaaggtgtaaatggagcaacttaccttactttattcttgaaccaatttaattttgctgat
ggtgctgctgctttcattaaagttggagctgaaaaacttcttgaagaccatgaaggtgaa
aaattgggaacagcttatgttgatgaattaatgggtaatacttcaatgaacgctggtgtt
tggtcatttgatgagaattctgaaggtaaaatcgcgcttaacttccgtttcccacaagga
aatagtccagaacgtatgcaagaaattcttgctaaacttgatggtgttgttgaagttgaa
ctttcaaaacatcttcatgttccacattatgttccaatgtcagacccacttgtatcaaca
ttgattgatgtttatgaaaaacacacaggcctcaaaggttatgaaacaatcattggtggt
ggaacttttggtcgtcttttagaacgtggtgttgcttatggtgcgatgtttgaaggggaa
cctgattcaatgcaccaagctaatgaaatgaaacctgtcgaaaatatttataaagctgca
gtaatttatgctgaagcaatttatgaacttacaaagtaa

DBGET integrated database retrieval system