KEGG   Lactococcus lactis subsp. lactis Il1403: L86157Help
Entry
L86157            CDS       T00045                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lla00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    L86157 (rbsK)
Enzymes [BR:lla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     L86157 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
complement(1686409..1687311)
Genome map
AA seq 300 aa AA seqDB search
MTKVSVIGSISMDLVTRTNRVPNAGETVFGEDFAMVPGGKGANQAVAFARLSPNEVSMIG
AVGKDAFGESILQNFKENAVLFENVGTVPQTTGIAQITLYDDDNRIIIIPGANNEVLPSY
LADLWEKIKESQLVILQNEIPHETNLAIAKFCKENAIKVLYNPAPARKTDLEMIDFVDYI
TPNEHECKELFPNLALEEILKKYSNRLIVTLGSEGVIFHDGETLQKIPAIKAKVVDTTGA
GDTFNGAFAFGLTENLSISDSIRLAVVASHLSIQKFGAQGGMPKLSEVKAKLKELEINLY
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagtaagtgttataggaagtatttcaatggatttagtcacaaggactaaccga
gtgccgaatgctggagaaacagtatttggtgaagatttcgctatggttcccggtggaaaa
ggagcgaaccaagccgttgcttttgccagactttctcccaatgaagtaagtatgattgga
gcagtaggcaaggatgcttttggtgagagtattttgcaaaacttcaaagaaaatgcagtt
ctttttgaaaatgtgggaacggtaccacaaacaacaggaattgctcaaattactctctat
gatgacgataatcgtattattattattccaggtgctaataatgaagttctaccaagttat
ctagcagacctttgggagaaaattaaagaaagccaacttgttattctacaaaatgaaatt
ccacatgaaacaaatctagcgattgctaaattctgtaaagaaaatgcgataaaagttctt
tataatccagctccagcaagaaaaacagatttggaaatgattgattttgttgattatatc
acaccgaatgaacacgaatgtaaggaactttttccaaatttagcacttgaagaaattctc
aaaaaatattcaaatcgtctgattgtcaccttaggaagtgaaggagtcattttccacgat
ggagagactcttcaaaaaattcctgccataaaagctaaagttgtagatacaactggtgca
ggagatacattcaacggagcctttgcctttggtttgactgagaacttatcaattagtgat
tctatcagattagctgtcgttgcttctcatttatctattcaaaaatttggcgcacaaggc
gggatgccaaagctatcagaagttaaagcaaaattaaaagaacttgaaattaatctctac
taa

DBGET integrated database retrieval system