KEGG   Lactococcus lactis subsp. lactis Il1403: L89194Help
Entry
L89194            CDS       T00045                                 

Gene name
bglH
Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    L89194 (bglH)
Enzymes [BR:lla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     L89194 (bglH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
complement(1489446..1490882)
Genome map
AA seq 478 aa AA seqDB search
MTFKTDFLWGGATAANQLEGAYDIDGKGLSVADAMPGGKERLAILASPEFDWTIDIEHFT
YPNHDGIDHYHHFKEDIALFAEMGFKAYRFSVAWSRIFPMGDETTPNEKGLLFYDQLIDE
CLKYGIEPVVTISHYEMPLNLAKTYGGWKNRELIEFYVRFAKVLLERYQDKVKYWMTFNE
INSATFFSGLSQGLVPSNGGDDKTNVFKAWHNQFVASAQAVKFGHDLNKSLQIGCMSIYS
TTYSFDANPVNQLATQESIQEFNYFCNDVQVRGAYPAFTNRLHRKHGVNADALEISEEDL
KIIKEGTVDYIGFSYYMSTVESKTGEGVQASGNMVLGGVKNPFLKESEWGWAVDPDGLCY
ALNDLYGRYQVPLFIVENGLGAIDKVQEDGTIQDDYRIDYLKKHIQSMNEAVEDGVDLMG
YTPWGCIDLVSASTGEMSKRYGFIYVDLDDEGKGTKKRSKKKSFDWYKEVIASNATNL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacatttaaaacagactttttatggggtggagcaacggcagcaaatcaattagaaggt
gcttatgatatagatggtaaagggctctcagtagcagatgcaatgccaggaggtaaagaa
agattggcaattcttgcaagtcctgaatttgattggacgattgatattgaacattttact
tatccaaatcatgatggaattgatcattatcatcattttaaagaagacattgcattattt
gcagaaatgggatttaaagcttaccgtttttcggtagcttggtcaagaatttttccaatg
ggagatgaaacaactccaaatgaaaaaggtttgcttttttatgatcagctaattgatgag
tgtttgaaatatggaattgaaccagtggttacaatttcccactatgaaatgccacttaat
ttagctaaaacatatggaggatggaaaaatcgcgaactaatcgaattttatgtccgtttt
gcaaaagttttgttagaacgttatcaagacaaagtgaaatattggatgacttttaacgaa
atcaattcagcaacattcttttcaggtttaagtcaaggacttgttccatctaatggtgga
gatgacaaaactaatgttttcaaagcttggcataatcaatttgttgcaagtgctcaagct
gtaaaatttgggcatgacttgaataagagtttacaaattggttgtatgagtatttattca
acaacttattcgttcgatgcaaacccagtaaatcaattagcaacacaagaaagcattcaa
gagtttaattatttctgtaatgatgtacaagttcgaggagcctatcccgcatttacgaat
cgacttcaccgtaaacacggagtaaatgcagatgcacttgaaatttccgaagaagatcta
aagataataaaagaaggaacagttgattatataggatttagttattatatgtcgactgta
gaatcaaaaacaggggaaggcgttcaagcttcaggaaatatggttcttggaggagttaaa
aaccccttcttaaaagaaagcgaatggggttgggcagttgaccctgacggactttgttat
gcccttaatgatttatacggtcgctatcaagttccgctcttcattgtcgaaaatggctta
ggcgcaattgataaagtacaagaagacggaacgatacaagatgattatcgtattgattat
ctcaaaaaacacattcaatcaatgaatgaagcagttgaagacggcgttgacctaatgggt
tacacgccttggggatgtattgatttagtttcagcatctacaggagaaatgagtaagcgt
tatggattcatctacgttgacttagatgacgaaggaaaaggaacaaaaaaacgttctaag
aaaaaatcatttgattggtataaagaagtaatagcttcaaatgctaccaacttgtaa

DBGET integrated database retrieval system