KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_0382Help
Entry
LACR_0382         CDS       T00420                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
llc00010  Glycolysis / Gluconeogenesis
llc00260  Glycine, serine and threonine metabolism
llc00680  Methane metabolism
llc01100  Metabolic pathways
llc01110  Biosynthesis of secondary metabolites
llc01120  Microbial metabolism in diverse environments
llc01130  Biosynthesis of antibiotics
llc01200  Carbon metabolism
llc01230  Biosynthesis of amino acids
Module
llc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
llc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LACR_0382
  Energy metabolism
   00680 Methane metabolism
    LACR_0382
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LACR_0382
Enzymes [BR:llc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LACR_0382
Membrane trafficking [BR:llc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LACR_0382
Exosome [BR:llc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LACR_0382
  Exosomal proteins of melanoma cells
   LACR_0382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABJ71989
JGI: LACR0382
UniProt: Q031Y3
Position
347180..347881
Genome map
AA seq 233 aa AA seqDB search
MPKLVFARHGESEWNLANLFTGWADVDLSENGTKQAIEAGKLIKEAGIEFDIAYTSVLKR
AIKTTNLALEFSDQLWVPVVKSWRLNERHYGGLTGLNKADAAAKHGDEQVHIWRRSYDVL
PPAMDHDDKYTAHGDRRYAGLEDSLIPDAENLKVTLERALPFWEDQIAPALKEGKNVFVG
AHGNSIRALVKQIKKLSDDEIMDVEIPNFPPLVFEFDDNLNVQNEYYLAPKKA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagtatttgcacgtcacggtgaatctgaatggaatcttgctaaccttttc
acaggttgggctgacgttgacctttctgaaaacggaactaaacaagcgattgaagctggt
aaattgattaaagaagctggaatcgaatttgatattgcatacacttcagtattgaaacgt
gcgatcaaaacaactaaccttgctcttgaattttcagatcaactttgggtaccagttgtt
aaatcatggcgcttgaacgaacgtcactacggtggtttgacaggtttgaacaaagctgac
gctgctgcaaaacatggtgatgaacaagttcacatctggcgtcgttcatatgatgtattg
ccacctgcaatggatcatgatgataaatatacagctcacggagaccgtcgttatgctggt
cttgaagattcattgattcctgatgctgaaaacctcaaagttactttggaacgcgctctt
ccattctgggaagaccaaatcgctccagctttgaaagaaggaaaaaatgtcttcgttggt
gctcacggtaactcaattcgcgccctcgttaaacaaatcaaaaaactttctgatgacgaa
attatggatgttgaaatccctaacttcccaccacttgttttcgaatttgatgacaatttg
aacgttcaaaacgaatactatttggctccaaaaaaagcttaa

DBGET integrated database retrieval system