KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_0523Help
Entry
LACR_0523         CDS       T00420                                 

Definition
Beta-glucosidase-related glycosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LACR_0523
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    LACR_0523
Enzymes [BR:llc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LACR_0523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
492938..494149
Genome map
AA seq 403 aa AA seqDB search
MTKRLKKQAKPVVFLGIVIGCALIVSGVLGLSGHLNNQEAIKSKKKNQVSETKTNSSSQN
KSDQKMPKMTLEQKVGQLFMTGMPANNYDQATFDAIEKYQVGSIILTGRSNLSIPEMKVI
TDKLQGLAPANRRLLISCDQEGGNVQVLQGTGFSEMPNGLIQGSWAPEKLQEEAKNWGSE
LSTAGINFDLAPVADQVLSADFAPQNAPIGYWSRQYAYDKANIVSHADAFSKGMKSAGVL
TTAKHFPGLGAVTGNTDISAGVRDSQTNPKSESVQIFKELISSGVPSIMTATAIYDQIDP
ELPGAFSPKMVDGLLRNQLGFDGLVITDDLSNAVQVQAWSPGQRAVLALAAGNDLVLANE
PTQIPEMISEVLQKAKSDQGFAEKINQASSRVMKVKEQMKLVE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaaagattaaagaagcaagcaaaaccagtcgtttttctaggcattgttattggt
tgtgcacttattgtgtcaggagttcttggtctgtcaggacatttaaataatcaagaagca
atcaaaagtaaaaagaaaaatcaagtttcagaaacaaaaactaattcaagtagtcaaaat
aaaagtgaccaaaaaatgccaaaaatgactttagaacaaaaagtgggtcagttatttatg
acggggatgcctgcaaataactatgaccaagcaacttttgatgcgattgaaaaatatcag
gttgggagtatcattttgacgggccgctctaatctcagtattcctgaaatgaaagttatt
actgacaagctacaaggcttagcaccagctaatcgacgtcttttgatttcttgtgatcaa
gagggaggaaacgttcaggttcttcaagggactggtttttcagaaatgcctaatggattg
attcaaggaagttgggcgccagaaaaattacaagaagaagctaaaaattgggggagtgaa
ctttcaaccgctggaatcaattttgatttagccccagttgctgaccaggttttatctgct
gattttgcaccacaaaatgctccgattggctactggagtcgtcagtatgcttatgacaaa
gctaatattgtcagccatgccgatgctttttctaaaggaatgaaatcagctggtgtttta
acaaccgctaagcattttccagggcttggagcggtgacaggtaacacggatatcagtgct
ggcgtcagagatagtcaaacaaatcctaaaagtgaatccgttcagatttttaaagaatta
atttcttcgggagttccatcaattatgacggcgacagcaatttatgatcaaattgaccct
gagcttccgggagccttctcacctaaaatggttgatggcttactccgaaatcaattaggc
tttgatggtttggtaattactgacgatttatcaaacgctgttcaagttcaagcttggtca
ccaggccaaagagcagtattggcgctggcagcgggaaatgaccttgtcctagccaatgag
cccactcaaattccagaaatgatttcagaagttttgcaaaaagcaaaatctgatcaggga
tttgcagaaaaaattaatcaagcatcatcaagggtgatgaaagtaaaagaacaaatgaaa
cttgtagaatag

DBGET integrated database retrieval system