KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_0723Help
Entry
LACR_0723         CDS       T00420                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LACR_0723
Enzymes [BR:llc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     LACR_0723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
667218..669221
Genome map
AA seq 667 aa AA seqDB search
MVTNTFSIEPYGEKAYHTGIAVPVFSLRTENSSGVGQFSDLKKLADFTYRSGMDVIQLLP
INDTTTFMDWRDSYPYRAISVFALHPLYLDIHEFWKSYTKEQQEKLLILESELNSLEKID
YERCLALKWEYAQIIYQNLAVKYQKTKSYQQFYKQNEEWLKAYACFSYLRDINKSANFLA
WGKNANYDKNLFDKLKKETSQLDLYIFVQYLLHSQLTEAVDYCHKLGIALKGDIAIGIAH
DSVDAWTHPELFHLDKQAGAPPDVFAVNGQNWGFPTYNWEKMAEDGYDWWKKRLTAMSNY
FDAYRLDHILGFFRIWQMPENSVRGLLGQFSPALALSAEEIENNYGIPFRQWGIERFILP
FIKDWVIDEVFGRDNRDWIIQTFLDYIGDSNYRFKAEFNNQKAIENTQMENWVREGLYKL
QENVIFLKDDENSEKYHPRIGLLSTISFREFGDDYKGRLERLYNDYFYGRNYDFWKEKAY
EKLPALKNATKMLACGEDLGMVPDNVPDVMYHLDILRLIIERMPADERFVSSLSEVPYLS
VVTTSSHDTSPLRAWWEENHDLTQRYYNEVMGWYGEAPNYASVEIIQEIIKRNLNSNAMM
VILPIQDWLAMSEHFRKENAKSEQINIPADPYHYWNYRLHCNLQALIENQEWTDFLKNFI
KESKRAY
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggtaactaacacattttcaattgaaccctatggagaaaaagcttaccataccggaata
gcagtaccagttttttctcttagaacggaaaactctagcggagtaggtcagttctcagac
cttaagaaattggctgattttacctatcgctctggcatggatgtcatccaattactacca
attaatgatacgacgacttttatggattggcgagattcctatccttatcgggcaatttcc
gtttttgctttgcatccactctatttagacattcatgaattttggaaatcttacacaaaa
gagcaacaagaaaaacttttgattttagaatcagaactaaattctttagaaaagatagat
tatgaaagatgtctggcattaaagtgggaatatgcgcaaattatttatcaaaatttagcc
gtaaaatatcaaaaaaccaagtcttatcaacaattttataaacaaaatgaagaatggttg
aaggcctatgcctgtttttcctatttgagagacattaataagagtgctaattttttagct
tggggaaaaaatgcgaattatgataaaaatttatttgataaattaaaaaaagagactagc
cagttagatttatatatttttgtgcaatatcttctccattctcaacttactgaagcagta
gattattgtcataaattaggaattgctttaaaaggagacatagcgattggaattgctcac
gattctgtagatgcgtggacccatcccgaacttttccatcttgataaacaagctggtgcg
cctcctgatgtttttgccgtaaatggacaaaactggggattcccaacttataattgggaa
aagatggctgaagatggctatgattggtggaaaaaacgtctaaccgccatgtcaaattac
tttgatgcttatcgcctcgaccatattcttggattctttagaatatggcaaatgccagaa
aattcggtaagaggattgctaggtcaattttcacccgcactggctttgtcagcagaagaa
attgaaaataattatggaattccattccgacaatgggggattgagcgcttcatcttacct
ttcatcaaagattgggtgatagacgaagtttttggtcgagataatcgtgattggattatt
caaacatttttagactatattggtgatagtaactatcgttttaaagcagaattcaacaac
caaaaagcgatagagaatactcaaatggagaactgggttcgcgaaggactttataaatta
caagaaaatgtaatttttttaaaggatgatgaaaatagtgaaaagtatcatccacgaatt
ggtctgctatcaacaataagttttcgagaatttggtgatgactacaaaggacgattagag
cggctttacaatgactatttttatggtcgaaattatgatttttggaaagaaaaagcctat
gaaaaattgccagccttaaaaaatgcgaccaagatgttggcatgtggtgaggacttaggg
atggtgccagataatgtgccagatgtgatgtatcatcttgatatcttacgactgattatt
gaacgaatgcctgctgatgaacggtttgtcagctcattaagtgaagttccatatttatca
gtagtaaccacatctagccatgataccagccctttaagagcttggtgggaagaaaaccat
gatttaactcaacgttattacaacgaagtcatgggttggtatggagaagcgccaaactat
gcgagtgtagaaattatccaagaaataattaagagaaatttaaattctaatgccatgatg
gttatcttacctatccaagattggttagcaatgagtgagcattttagaaaagaaaatgca
aaatctgaacaaattaatattcctgcagatccgtatcattactggaattaccgactccat
tgtaatcttcaagcattgattgaaaatcaagaatggaccgattttctaaagaactttatt
aaagaaagcaagcgagcttattaa

DBGET integrated database retrieval system