KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1033Help
Entry
LACR_1033         CDS       T00420                                 

Definition
fusion of IIA, IIB and IIC component of mannitol/fructose-specific phosphotransferase system mannitol/fructose-specific
Orthology
K02768  
PTS system, fructose-specific IIA component [EC:2.7.1.69]
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
Fructose and mannose metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:llc00051]
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS) [PATH:llc02060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
974572..976476
Genome map
AA seq 634 aa AA seqDB search
MEIKDLLKTEVMILDLQATSKEAVIDEMVNKLVSEGYVSDFATFKAGIMAREAQTSTGLG
DGIAMPHSKNTAVNEPVVLFAKSKTGVDYAALDGQPVNLFFMIAAPDGANDTHLEALAQL
STYLLKDGFQDRLRKVEYPREVIQLFSEKQEEVATLENAEHYIVAVTACTTGIAHTYMAE
EALKKQALEMGVGIKVETNGARGIDNKLTSADIQKADAVIVAADKKVEMNRFAGKEMVQV
PVAHAIRDTEELINRALSGNAPIYEADGTDEVKEESSGGLGKAFYKHLMGGVSAMLPFVV
GGGILIALAFLIDQAMGVPQSQLANLGVYHPLAAYFKNVGGAAFAFMLPVLAGFIANSIA
DKPGLVAGFVAGSMASSGLAFGHLDPAKMIPSGFLGALVGGFLAGGVIIILRKVFAKLPR
SLDGIKAILIYPLVGTFITGFLMLFVNIPMAAINTGISNFLASLSGASALVLGLVVGGMM
AIDLGGPINKAAYIFATGTLAATVSTGGSVTMAAVMAGGMVPPLATTVAVILFKNKFTKE
ERNSGLTNIVMGLSFITEGSIPFGAADPARAIPSFMIGAAVAGGLTGMANIKLMAPHGGV
FVLALTNNPLLYLLFILIGAIVSGLLFGALKKAK
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaagatttattaaaaacagaggttatgattcttgacctccaagcaactagc
aaagaagctgttattgatgaaatggtcaataaattagtttctgaaggttatgtcagtgat
tttgcaacttttaaagcaggaattatggcacgtgaagcgcaaacttcaactggacttggt
gacgggattgccatgcctcacagtaaaaataccgctgttaatgaaccggttgttctattt
gcaaaatcaaaaactggtgttgattacgcggcattagatggtcaacctgtcaatcttttc
tttatgattgcagccccagatggtgctaatgatactcacttagaagctttggcacaactt
tccacttatcttcttaaagacggtttccaagaccgtttgagaaaagttgaatacccacgc
gaagtcattcaactcttttctgaaaaacaagaagaagttgcaactctagaaaatgctgaa
cattacattgtagctgtaacagcatgtacaacaggaattgcccatacttacatggctgaa
gaagcacttaaaaaacaagccttggaaatgggtgttggtataaaggttgaaaccaatggt
gcgcgtggaattgataataaattaacttcagctgatattcaaaaagctgatgctgttatc
gtagctgcggacaaaaaagtcgaaatgaatcgttttgctggtaaagaaatggttcaagtt
ccagttgcacacgccattcgagatacggaagaattaattaatcgtgcactttcaggaaat
gcaccaatctatgaagcagatggaacggatgaagtaaaagaagaatcatctggtggctta
ggtaaagctttctataaacacttaatgggtggtgtttctgcaatgcttccattcgttgtc
ggaggtgggattcttatcgctcttgctttcttgattgaccaagcgatgggagttcctcaa
agtcaattggccaaccttggagtttatcatcctttagctgcttactttaaaaatgttggg
ggcgcggcttttgcctttatgttacctgttttagccggtttcattgcaaactcaatcgct
gataagcctggtttagttgctggttttgtcgctggttcgatggcatcatctggtttggcc
tttggtcatttagaccctgctaaaatgattccgtcaggtttcttaggcgccttggttggt
ggtttccttgccggtggagtaattattattcttcgtaaagtcttcgcaaaacttccacgt
tcacttgatgggattaaagctatcttgatttatccattagttggaacatttatcacaggt
ttcctaatgctctttgtcaatatcccaatggctgcaattaataccggaatttctaacttt
ttagcaagcttatcaggagcatctgcccttgttcttggtctagttgttggtggaatgatg
gctattgaccttggtggtccaatcaacaaagctgcttatatctttgcaactggtacttta
gcagcaacagtttcaactggtggttcagtaacaatggcagcagttatggctggtgggatg
gttccaccactcgcaactacagtagctgttatcttgttcaaaaataaatttaccaaagaa
gaacgtaattctggtttgacaaacattgtgatggggctttcattcatcactgaagggtca
attccatttggcgcagccgacccagcacgcgcaattccatcatttatgattggagcagca
gtagccggtggtttgactggtatggccaatattaaattgatggcaccacatggtggagtc
ttcgtacttgctttgactaataacccgttactttatctcttgttcatcttgattggagca
attgtttcaggcctattatttggagctttgaaaaaagctaaataa

DBGET integrated database retrieval system