KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1208Help
Entry
LACR_1208         CDS       T00420                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LACR_1208
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LACR_1208
Enzymes [BR:llc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     LACR_1208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1121050..1122399)
Genome map
AA seq 449 aa AA seqDB search
MTIKTSFAKFAGNSSRFVLEKFFKRGSTLPGKIALKFDPEILKSLTKNYEIIVVTGTNGK
TLTTALTVGILEKAFGPVVTNPTGANMITGIVSTFLKAPKAKTGEKKFAVLEIDEASLPK
ITEYIKPSLFVFTNIFRDQMDRYGEIYTTYDLIVKGAANSPKGTVLLNGDSPLFNSKKLV
NPVKYYGFNHESHEATHAHYNTEGIVCPVCHHILAYKMNTYANLGNYICENCGFSRPELD
YQLTELSEITNTSSKFIIDGTDYKINVGGLYNIYNALAAVSVAEYFNVPKETIAAGFELS
KAVFGRQETLEIDGKKVTIVLIKNPVGANQALEMMKLANYPFTLVSLLNANYADGIDTSW
IWDANFELINDMEIDQIITGGVRSSEMARRMRVTGFDAQKISERKELSEVLEAIKESKKD
HVYILATYTAMLQMRELLAESHYLGKEMR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgacaataaaaacttcatttgcaaagtttgctggtaattcatcgcgctttgtcttggaa
aaatttttcaagcgtggctcaactttaccaggaaaaattgctttaaaatttgaccctgaa
attcttaaatcactgaccaaaaattatgaaatcattgttgtgactgggaccaatggaaaa
acattgaccacagctttgaccgtgggaattttagaaaaggcttttggaccagttgtgaca
aatccaactggagccaatatgatcacggggattgtatctacctttttgaaagctcccaaa
gcgaaaactggcgaaaagaaatttgctgtccttgagattgatgaagcgagtttgccaaaa
atcactgaatacatcaaaccttcattatttgttttcacaaatattttccgtgaccaaatg
gaccgctatggagagatttacaccacctacgatttaatcgtcaaaggtgcggcaaatagc
cctaaaggtactgttttattaaatggtgatagtccacttttcaactcaaaaaaattagtt
aatcctgtaaaatattatggctttaaccacgaaagtcatgaagctactcatgctcattac
aataccgaggggattgtttgtccagtttgtcatcatattttggcttacaagatgaacacc
tatgctaacttgggaaattatatttgtgaaaattgtggctttagtcgtccagaattagat
tatcaactgacagaattatccgagattacaaatacttcttctaaatttatcattgatggg
acagattataaaatcaatgtcggtggactttataacatctacaatgcccttgctgctgtc
tctgttgctgaatatttcaatgtgccaaaagaaacaattgcggctggttttgaactttcc
aaagcagtttttggtcgtcaagaaactcttgaaatcgatggaaaaaaagtaaccattgtt
ttgataaaaaatccagtaggtgcgaatcaagcccttgaaatgatgaaattagccaattat
cctttcactttagttagccttttgaatgccaattatgctgacggaattgacacaagttgg
atttgggatgctaattttgaattaattaatgacatggaaattgaccaaattatcacaggc
ggtgttcgttcatctgaaatggctagacgtatgcgagtgactggatttgatgcccaaaag
atttccgagcgtaaagaactttcagaagtattagaggcaatcaaagaaagtaaaaaagat
catgtctatattttggcaacttatactgccatgttgcaaatgcgtgaactactggctgaa
agtcattatcttggaaaggaaatgcgttaa

DBGET integrated database retrieval system