KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1244Help
Entry
LACR_1244         CDS       T00420                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LACR_1244 (tpiA)
   01230 Biosynthesis of amino acids
    LACR_1244 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LACR_1244 (tpiA)
   00051 Fructose and mannose metabolism
    LACR_1244 (tpiA)
   00562 Inositol phosphate metabolism
    LACR_1244 (tpiA)
Enzymes [BR:llc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LACR_1244 (tpiA)
Exosome [BR:llc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LACR_1244 (tpiA)
  Exosomal proteins of bladder cancer cells
   LACR_1244 (tpiA)
  Exosomal proteins of melanoma cells
   LACR_1244 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1160028..1160786
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKTLSEAQAFVEAVKNNLPSSDNVESVIGAPALFLAPMAYLRQGSEL
KLAAENSYFENAGAFTGENSPAAIVDLGVEYIIIGHSERREYFHETDEDINKKAKAIFAA
GATPILCCGETLETFEAGKTAEWVSGQIEAGLAGLTAEQVSNLVIAYEPIWAIGTGKTAT
NEIADETCGVVRSTVEKLYGKEVSEAVRIQYGGSVKPETIEGLMAKENIDGALVGGASLE
ADSFLALLEMYK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattatcgctggtaactggaaaatgaataaaactttgtcagaagca
caagcttttgttgaagctgttaaaaataacttgccttcatctgataatgttgaatcagtt
atcggtgcacctgctcttttcctcgctcctatggcttaccttcgtcaaggttcagaattg
aaacttgctgctgaaaatagctacttcgaaaatgctggagcattcactggtgaaaacagc
ccagctgcaatcgttgaccttggtgttgaatacatcatcatcggtcacagcgaacgtcgt
gaatatttccacgaaactgacgaagacatcaacaaaaaagcaaaagcaatcttcgctgct
ggagcaactccaatcctttgttgtggtgaaactttggaaacttttgaagctggtaaaaca
gctgaatgggtttcaggtcaaatcgaagctggtcttgcaggattgactgctgaacaagtt
tcaaacttagttatcgcttacgaaccaatctgggcaattggaactggtaaaactgcgaca
aacgaaattgctgacgaaacttgtggtgttgtacgttcaacagttgaaaaactttacgga
aaagaagtttcagaagctgtacgtatccaatacggtggatcagtaaaacctgaaacaatc
gaaggattgatggctaaagaaaacatcgacggtgccctcgttggtggagcttcacttgaa
gctgatagcttccttgcattgcttgaaatgtacaaataa

DBGET integrated database retrieval system