KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1270Help
Entry
LACR_1270         CDS       T00420                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LACR_1270
   00670 One carbon pool by folate
    LACR_1270
Enzymes [BR:llc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LACR_1270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1179915..1180436
Genome map
AA seq 173 aa AA seqDB search
MRGVAMIIGIWAEDEQGLIGEADKMPWSLPAEQKHFKETTMNQVILMGRKTFEGMNKRVL
PGRISIILTRDETYQSENEKVLIMHSPKEVLDWYYKQDKDLFITGGAEILALFESELELL
YRTVVHEKFQGDTYFPTHFDFGKYKVVSEIFHDKDERNAYTFTIKKYEKVKQP
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgagaggggttgctatgataattggaatatgggcagaagatgagcaaggacttatcgga
gaagctgacaaaatgccttggtctttacctgctgaacaaaaacattttaaagaaacaacc
atgaatcaagtgattttgatgggacgaaaaacctttgaaggaatgaacaaacgtgttttg
ccggggagaataagtattattttaactcgtgacgaaacttatcaatctgaaaatgaaaaa
gttctcatcatgcacagccctaaagaagttctggattggtattataagcaggataaagac
ttgtttatcacgggaggcgctgaaatattagccctttttgaatcagaacttgaattgctt
tatcgaacagttgttcatgaaaaatttcaaggagatacttatttcccaactcattttgac
tttgggaaatacaaagtggtttcggaaatttttcacgataaagatgagcgaaatgcttat
acttttacgattaaaaaatatgaaaaagtgaaacaaccatga

DBGET integrated database retrieval system