KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1270Help
Entry
LACR_1270         CDS       T00420                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:llc00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:llc00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1179915..1180436
Genome map
AA seq 173 aa AA seqDB search
MRGVAMIIGIWAEDEQGLIGEADKMPWSLPAEQKHFKETTMNQVILMGRKTFEGMNKRVL
PGRISIILTRDETYQSENEKVLIMHSPKEVLDWYYKQDKDLFITGGAEILALFESELELL
YRTVVHEKFQGDTYFPTHFDFGKYKVVSEIFHDKDERNAYTFTIKKYEKVKQP
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgagaggggttgctatgataattggaatatgggcagaagatgagcaaggacttatcgga
gaagctgacaaaatgccttggtctttacctgctgaacaaaaacattttaaagaaacaacc
atgaatcaagtgattttgatgggacgaaaaacctttgaaggaatgaacaaacgtgttttg
ccggggagaataagtattattttaactcgtgacgaaacttatcaatctgaaaatgaaaaa
gttctcatcatgcacagccctaaagaagttctggattggtattataagcaggataaagac
ttgtttatcacgggaggcgctgaaatattagccctttttgaatcagaacttgaattgctt
tatcgaacagttgttcatgaaaaatttcaaggagatacttatttcccaactcattttgac
tttgggaaatacaaagtggtttcggaaatttttcacgataaagatgagcgaaatgcttat
acttttacgattaaaaaatatgaaaaagtgaaacaaccatga

DBGET integrated database retrieval system