KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1276Help
Entry
LACR_1276         CDS       T00420                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:llc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1184034..1185107
Genome map
AA seq 357 aa AA seqDB search
MKILELNQESFSLKNIVIKFEELSNDELTGLQKKLYRIGSLAKLSENSFLAVLTIDELAK
LLNHLENIEVKNELELIYKRHQIIWSGKNFNFDLTRKSIVYSIVNVTPDSFYDGNPDNLN
ISHIIKRVESDLENGASVLELGGKSSRPGYADISPEEEWSRLKEPISQIRKYFPKAVLAV
DTDEAYVMERVLEAGVDIINDIDGFDTADKLKVIEKYQPAVVAMNNGRAGFKYADNVYEE
LPLFFKDKKIELTQLGLNPEKISIDPGVGFFNGDSGSDSLQRVKTTELLSRLGLPVMIAI
SRKSFMGRLFNAQGEERLFSSLILEGQMVADGGRILRVHDVKETKRLLDAIEIYKEF
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcttagaacttaatcaagaatctttttctttaaaaaatattgtgataaaattt
gaagaattaagtaatgatgaattgacaggcttacaaaaaaagctttataggattggaagt
cttgcaaaactgagcgaaaatagttttctagctgttttaactattgatgagttggcaaaa
ctacttaatcatttggaaaatattgaagtaaaaaatgagcttgaattgatttataaacgg
catcaaattatttggtcaggaaaaaatttcaattttgatttgactagaaaatcaatcgtt
tactcaattgttaatgttactcccgattctttttatgatggtaatccagataatttaaac
atttcccatattattaaaagagtagagtccgatttagaaaatggagcatctgtacttgag
ttaggtggaaaatcatctcgtcctggttatgcggacattagtccagaggaagaatggagc
agattaaaagaacccatttctcaaattagaaagtattttccaaaagctgtcttagccgtg
gatacggatgaagcttatgttatggaaagggtgttagaggctggtgtcgatattattaat
gatattgatggttttgacacagcggataagctaaaagtgattgaaaagtaccagccagca
gtggttgccatgaataatggtcgggcaggttttaagtatgctgacaatgtctatgaagaa
cttcctttattttttaaagataaaaaaatcgaactgactcagcttggactgaatcctgaa
aaaatttctattgaccccggagttggttttttcaatggagattcaggctctgatagtctt
caacgtgttaaaacaacggaacttttgagcagacttggtctgccggtcatgattgcgatt
tctcgcaagtcatttatgggaagactcttcaatgctcaaggagaagagcgacttttttca
agtttgatcttagagggacaaatggttgctgacggtggacgtatccttagagttcatgat
gtgaaagaaacgaaacgtttgcttgatgcaattgaaatttataaggaattttaa

DBGET integrated database retrieval system