KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1457Help
Entry
LACR_1457         CDS       T00420                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LACR_1457
   01230 Biosynthesis of amino acids
    LACR_1457
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LACR_1457
   00030 Pentose phosphate pathway
    LACR_1457
   00051 Fructose and mannose metabolism
    LACR_1457
   00052 Galactose metabolism
    LACR_1457
  Energy metabolism
   00680 Methane metabolism
    LACR_1457
Enzymes [BR:llc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LACR_1457
Protein phosphatases and associated proteins [BR:llc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LACR_1457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1379409..1380431)
Genome map
AA seq 340 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGIEVYGINHGYAGMVAGDIFPLTSASVGDK
IGRGGTFLYSARYPEFAQVEGQLAGIEQLKKFGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDFTIGFDTAVSTVVDALDKIRDTSSSHNRTFVVEVMGRNAGDIALNA
GIAAGADDICIPEKEFKFENVVNNINKGYEKGKNHHIIVLAEGVMTGEEFATKLKEAGYK
GDLRVSVLGHIQRGGSPTARDRVLASRMGARAVELLRDGIGGVAVGIRNEELVESPILGT
AEEGALFSLTTEGGIKVNNPHKAGLELYRLNSALNNLNLN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattgcagttttgacttctggtggtgatgccccagggatgaatgcggctatt
cgtgcagttgttcgcaaagcaatttctgaaggtatcgaagtttacggtatcaatcacgga
tatgcgggcatggttgcgggagacattttcccgcttacgtcagcttcagttggtgataaa
atcggtcgtggtggtacattcttgtactcagcacgttacccagaatttgctcaagtagaa
ggacaacttgctgggattgagcaacttaaaaaattcggtatcgaaggtgtcgttgtaatc
ggtggtgacggatcttaccatggagctatgcgtcttacagaacatggtttcccagctgtt
ggacttccaggcacaatcgataacgatatcgtaggaactgattttacaattggttttgat
acagcggtttcgacagtcgtagatgccttggataaaatccgtgatacttcatcatcacat
aaccgtactttcgttgtagaagtaatgggacgtaatgctggagatatcgctttgaatgct
ggtatcgctgctggtgcagatgatatttgtattccagaaaaagaatttaagtttgaaaac
gtagttaacaacattaacaaaggctacgaaaaaggtaaaaatcaccacatcatcgttctt
gctgaaggcgttatgactggtgaagaatttgctacaaaacttaaagaagctggttataaa
ggagaccttcgtgtttctgttcttggacacatccaacgtggtggttcaccaacagctcgt
gaccgtgttcttgcttcacgtatgggagctcgtgccgttgaattgcttcgtgatggaatc
ggtggcgtagccgttggtatccgtaatgaagaacttgtagaaagtccaattctcggaact
gctgaagaaggagcactctttagtttgactactgaaggtggcatcaaagtaaacaacccg
cataaagcaggtcttgaactttaccgtcttaactcagcactcaacaatcttaaccttaac
taa

DBGET integrated database retrieval system