KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1462Help
Entry
LACR_1462         CDS       T00420                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LACR_1462
   00052 Galactose metabolism
    LACR_1462
   00500 Starch and sucrose metabolism
    LACR_1462
   00520 Amino sugar and nucleotide sugar metabolism
    LACR_1462
Enzymes [BR:llc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LACR_1462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1385345..1386286
Genome map
AA seq 313 aa AA seqDB search
MKQTTIPNKARKVRKAVIPAAGLGTRFLPATKAIAKEMLPIVDKPTIQFIVEEALKSGIE
DILIVTGKAKRPIEDHFDSNIELEQNLLEKGKTELLKLVEETTDINLHFIRQSHPKGLGH
AVLQAKAFVGNEPFVVMLGDDLMNITGNETPLTKDLINDYEKTHASTIAVMKVPHEDVDK
YGVIDPNGEVSKGLYNVERFVEKPKVEEAPSDLAIIGRYLLTPEIFDVLETQVPGAGNEI
QLTDAVERLNKTQRVFAHEFTGKRYDVGDKLGFVETTIEYGLEHPQIGDNLRNYIIEKAK
ELSKDEPKQNTKK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaactactatacctaacaaagccagaaaagttcgtaaagctgttattcctgct
gctggtcttggaactcgctttttaccagcaactaaagccattgccaaagaaatgttgcca
attgttgataaacctactatccaattcatcgttgaagaagctttgaaatctggaatcgaa
gacattttgattgtaactggtaaagcaaaacgtccaattgaagaccattttgactcaaat
attgagcttgaacaaaatttgcttgaaaaaggaaaaacagaattacttaaacttgtagaa
gaaacaacagatatcaatcttcattttatccgccaatctcatccaaaaggtttgggtcac
gctgttcttcaagccaaagcttttgttggcaacgaaccttttgtagttatgcttggtgat
gatttgatgaatatcacaggcaatgaaactcctttgactaaagacttgattaatgattat
gaaaaaactcatgcttcaacaatcgctgtaatgaaagtgcctcatgaagatgttgacaaa
tacggagtaatcgacccaaatggtgaagtttctaaaggtctttacaatgttgaacgtttt
gttgaaaaaccaaaagttgaggaagctccttcagaccttgcaattatcggtcgttacctc
ttgactccagaaatttttgatgttttagaaacacaagtacctggtgctggaaatgaaatt
caattaactgatgcggttgaacgtttgaataaaacacaacgtgtctttgctcatgaattt
actggaaaacgttatgatgttggtgataaacttggttttgtggaaacaacaatcgagtat
ggtttagaacacccacaaatcggtgacaatttgagaaattatatcatcgaaaaagctaaa
gaactttctaaagatgaaccaaaacaaaatacaaaaaaataa

DBGET integrated database retrieval system