KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1485Help
Entry
LACR_1485         CDS       T00420                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LACR_1485 (glpK)
Enzymes [BR:llc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LACR_1485 (glpK)
Exosome [BR:llc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LACR_1485 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1407155..1408672
Genome map
AA seq 505 aa AA seqDB search
MSEGLPLEATEKYIMAIDQGTTSSRAIIFDHDGKHVGTSQKEFTQYFPEAGWVEHDANEI
WNSVQSVIAGAFIESGIKPDQIAGIGITNQRETTVVWDKTTGLPIYHAIVWQSRQSASIA
DDLKNAGHAELFHKKTGLIIDSYFSATKIRWILDHVEGAQERAEKGELLFGTIDSWLVYK
LTDGKVHVTDYSNASRTMLFNINTLEWDQEILDLLNIPKIMLPKAVSNSEVYGLTKTYHF
FGSKVPIAGMAGDQQAALFGQMAFEPGMVKNTYGTGSFIVMNTGDKPQLSHNNLLTTIGY
GINGEINYALEGSVFVAGSSIQWLRDGLKIIEKASDSEAAALESKNEDEIYMVPAFVGLG
APYWDQDARGAIFGLTRGTTDKDLIKATLQGIAYQVRDILGAMGEDTGIKIPILKVDGGA
TNNEYLMQFQADILNTSVQRAGDLETTALGAAFLAGLAVGYWKDFDELKESAKEGKRFDV
QMEEERRNKLYSGWKKAVEATRSFE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagggattaccattagaagccacagaaaaatatatcatggcaattgaccaagga
accacaagttcgcgcgcaattatttttgaccatgacggaaaacacgtcggaacaagccaa
aaagagttcactcaatattttccagaagcaggctgggttgagcatgatgccaatgaaatt
tggaattctgttcagtcagtcattgctggtgcttttattgaatcaggaattaagccggac
caaatcgccggaatagggattactaatcaacgcgaaacaaccgttgtctgggataaaaca
actggtctcccaatctatcacgccattgtctggcaatctcgtcagtcagcttcaattgct
gatgatttgaaaaatgccggtcatgctgagctttttcataaaaaaacaggattgattatc
gactcatatttctcagccacaaaaattcgctggatattagaccatgtcgaaggggcacaa
gaacgtgcagaaaaaggcgaacttctctttggaacgattgacagttggctcgtctacaaa
ttaactgacggaaaagttcacgtcactgactattcaaatgccagcaggaccatgcttttc
aatatcaatactttagaatgggaccaagaaattcttgaccttctcaacattccaaaaatc
atgctaccaaaagccgtttctaattctgaagtttatggtctaacaaagacttaccacttc
tttggctcaaaagtaccaattgctggcatggcaggagaccaacaagctgcgctctttgga
caaatggcctttgaacctggcatggtcaaaaatacttatggcacaggttcatttatcgtc
atgaacacaggagataaacctcagctttcacacaacaatcttttgacaaccatcggttat
ggcattaatggtgaaattaattatgcccttgaaggttctgtttttgttgctggttcttct
attcagtggttacgcgatggtttgaagattattgaaaaagcaagcgactcagaagctgcc
gctcttgaatcaaaaaatgaagatgaaatctacatggttcctgctttcgtcggccttgga
gctccctattgggaccaagacgcccgtggtgcaatctttggactaactagaggaacaaca
gataaagacctcatcaaagcaactttacaaggaattgcctatcaagttcgtgatatttta
ggtgctatgggtgaagatacaggaatcaaaattcccattcttaaagttgatggtggagca
acgaataatgaatatctcatgcaatttcaagcagatattttaaatacttccgttcaaaga
gctggagatttagaaacaacggccctcggtgccgcattcctagccggtcttgccgttggt
tattggaaagattttgatgaacttaaagaatcagccaaagaaggaaaacgatttgacgtc
caaatggaagaagaacgccgcaataaactctattctggctggaagaaagccgtagaggca
acaagatcttttgaataa

DBGET integrated database retrieval system