KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1499Help
Entry
LACR_1499         CDS       T00420                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
llc00480  Glutathione metabolism
llc00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LACR_1499
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LACR_1499
Enzymes [BR:llc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LACR_1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin SCO1-SenC
Motif
Other DBs
NCBI-ProteinID: ABJ73008
JGI: LACR1499
UniProt: Q02YG4
Position
complement(1422051..1422524)
Genome map
AA seq 157 aa AA seqDB search
MNFYDFSAVKMNGETVSMSDYKGKVVIVVNTASKCGFTPQFEGLEKLYETYKDQGLEILG
FPCNQFANQDAGENTEINEFCQLNYGVTFTMFQKIKVNGKEAHPLYQFLKKEAKGALSGT
IKWNFTKFLIDQDGQVIERFAPKTEPEEMEEEIKKLL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttatgattttagtgccgttaaaatgaacggtgaaactgtttcaatgtctgac
tacaaaggaaaagttgtaatcgtagtcaatacagccagtaaatgtggttttactccacaa
tttgagggacttgaaaaattgtatgaaacatataaggaccaaggattagagattctagga
tttccttgtaatcagtttgctaatcaagatgctggtgaaaatacggaaattaatgaattc
tgtcagttgaattatggcgttacattcaccatgtttcaaaaaattaaagtaaatggaaaa
gaagctcatccactttatcaatttttgaaaaaggaagccaaaggggcgcttagtggaact
attaaatggaatttcacaaagtttttaattgaccaagatggacaagtcattgaacgattt
gcgcccaaaacagagcctgaagaaatggaagaagaaatcaaaaaattactttaa

DBGET integrated database retrieval system