KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1548Help
Entry
LACR_1548         CDS       T00420                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LACR_1548 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LACR_1548 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LACR_1548 (trpA)
Enzymes [BR:llc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LACR_1548 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1466345..1467106)
Genome map
AA seq 253 aa AA seqDB search
MKTLQAKLSNKKNNFVPYIMAGDHERGLEGLNETIQLLEQAGSSAIEIGVPFSDPVADGP
VIEQAGLRALAKNVSLSKILDSLKSIETEVPLVIMTYFNPVYQFGIENFVAALENTAVKG
LIIPDLPKEHEAYIKPFITDKDICLVPLVSLTTPISRQKELVVDAEGFIYAVAINGVTGK
ENAYSNQLDHHLETLSKLTDIPVLTGFGISTLTDVERFNKVSAGVIVGSKIVRDLHENKE
SDVIKFIKNAINF
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttacaagcaaaattgagcaataaaaaaaataattttgttccctatattatg
gcaggtgaccatgaaagaggattagaagggctcaatgaaaccattcaacttcttgaacaa
gccgggagttctgccattgaaattggtgtacccttctcagaccccgttgctgacggacca
gtaattgaacaagctggcttacgagccttagccaaaaatgtttcactatcaaagattctt
gacagcttaaaatcaattgaaacagaagttcctcttgtcattatgacttattttaatcct
gtctatcagtttggaattgaaaattttgttgcagctcttgagaatacagcagtaaaaggt
ctaattattcctgatttacctaaagaacatgaagcttacattaagccttttattactgat
aaggatatttgcttagtacctttggtgtcattaaccacaccaatttctcgtcagaaagaa
cttgtagtagatgccgaaggattcatttatgccgttgcgatcaatggagtaaccggaaaa
gaaaatgcttatagtaatcaacttgaccatcatttagaaacattgtctaaattaactgat
attcctgttttgacaggatttgggatttcaactttaacagatgttgaacgttttaataag
gtatcagcaggagtaatcgttggttcaaaaatagttagggatttacacgaaaacaaagaa
agtgatgttattaaatttattaaaaacgcaatcaatttttaa

DBGET integrated database retrieval system