KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1548Help
Entry
LACR_1548         CDS       T00420                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
llc00260  Glycine, serine and threonine metabolism
llc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
llc01100  Metabolic pathways
llc01110  Biosynthesis of secondary metabolites
llc01130  Biosynthesis of antibiotics
llc01230  Biosynthesis of amino acids
Module
llc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LACR_1548
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LACR_1548
Enzymes [BR:llc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LACR_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth DUF561
Motif
Other DBs
NCBI-ProteinID: ABJ73054
JGI: LACR1548
UniProt: Q02YB8
Position
complement(1466345..1467106)
Genome map
AA seq 253 aa AA seqDB search
MKTLQAKLSNKKNNFVPYIMAGDHERGLEGLNETIQLLEQAGSSAIEIGVPFSDPVADGP
VIEQAGLRALAKNVSLSKILDSLKSIETEVPLVIMTYFNPVYQFGIENFVAALENTAVKG
LIIPDLPKEHEAYIKPFITDKDICLVPLVSLTTPISRQKELVVDAEGFIYAVAINGVTGK
ENAYSNQLDHHLETLSKLTDIPVLTGFGISTLTDVERFNKVSAGVIVGSKIVRDLHENKE
SDVIKFIKNAINF
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttacaagcaaaattgagcaataaaaaaaataattttgttccctatattatg
gcaggtgaccatgaaagaggattagaagggctcaatgaaaccattcaacttcttgaacaa
gccgggagttctgccattgaaattggtgtacccttctcagaccccgttgctgacggacca
gtaattgaacaagctggcttacgagccttagccaaaaatgtttcactatcaaagattctt
gacagcttaaaatcaattgaaacagaagttcctcttgtcattatgacttattttaatcct
gtctatcagtttggaattgaaaattttgttgcagctcttgagaatacagcagtaaaaggt
ctaattattcctgatttacctaaagaacatgaagcttacattaagccttttattactgat
aaggatatttgcttagtacctttggtgtcattaaccacaccaatttctcgtcagaaagaa
cttgtagtagatgccgaaggattcatttatgccgttgcgatcaatggagtaaccggaaaa
gaaaatgcttatagtaatcaacttgaccatcatttagaaacattgtctaaattaactgat
attcctgttttgacaggatttgggatttcaactttaacagatgttgaacgttttaataag
gtatcagcaggagtaatcgttggttcaaaaatagttagggatttacacgaaaacaaagaa
agtgatgttattaaatttattaaaaacgcaatcaatttttaa

DBGET integrated database retrieval system