KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1549Help
Entry
LACR_1549         CDS       T00420                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LACR_1549
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LACR_1549
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LACR_1549
Enzymes [BR:llc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LACR_1549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1467106..1468311)
Genome map
AA seq 401 aa AA seqDB search
MTYNQPNNQGFYGQFGGQFVPETLMTAVKELEVAYEDSKKDPVFQAELKELLKDYVGREN
PLYFAKRLTEYAGGAKIYLKREDLNHTGAHKINNALGQVLLAKKMGKNKVIAETGAGQHG
VATATAAALFGMECTIYMGEEDVKRQSLNVFRMELLGAKVHSVTDGSRVLKDAVNAALRA
WVAQVEDTHYVMGSVLGPHPFPQIVRDYQAVIGQEARAQFLEKENKLPDALVACVGGGSN
SMGLFYPFVNDESVEMYGVEAAGLGIDTPHHAATITKGRPGVLHGTLMDVLQDENGQILE
AFSISAGLDYPGIGPEHSYFNAVGRAKYVDITDEEALEGFKILSRTEGIIPALESSHAIA
YAVKLAKELGSEKTMIVCLSGRGDKDVVQVKERLEAEKEVK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaatcaacccaataaccaaggattttatggacaatttggtggacaatttgtc
cctgaaactttaatgacagccgtaaaagaattagaagtagcttatgaagacagtaaaaaa
gatccagtttttcaagctgaactaaaagaattgcttaaagattacgttggacgagaaaac
ccactttattttgctaaacgcctgaccgaatatgctggtggtgcaaaaatttatctcaaa
cgcgaagaccttaatcacaccggagctcacaaaataaataacgcccttggccaagtcctc
cttgccaaaaaaatgggaaaaaacaaagtcattgctgagacaggagcgggccaacatgga
gtcgcaacagcaacagcggctgccctctttggcatggaatgtaccatatatatgggtgaa
gaagatgtcaaaagacaatctcttaatgtttttcggatggaattgctcggtgcaaaagtc
cattcagttactgatggttcgcgcgtgcttaaagatgcggtaaatgcagcacttagagca
tgggttgctcaagttgaggatacacattatgtgatgggttcagttctcggacctcaccca
ttcccacaaattgttcgtgattatcaagccgtcattggtcaagaagcacgtgcacaattc
ttagaaaaagaaaataaactaccagatgctttagtggcttgtgttgggggcggttcaaac
tcgatgggacttttctacccattcgttaatgacgaatcagtagagatgtatggtgttgaa
gcagctgggcttgggatagatactccacaccatgcagcaacaattactaaagggcgtcca
ggggttttacacggcacgcttatggatgttcttcaagatgaaaatggacaaatactagaa
gctttcagtatttctgctggtttagactatccaggaattggacctgaacattcctatttc
aatgcggtcggccgtgcaaagtatgttgatattactgatgaagaagcccttgaaggtttc
aaaatcttatctcgcacagaaggaatcataccggcccttgaaagctctcacgcgattgcc
tatgcggtcaaattagctaaagaattaggttcagaaaaaacaatgattgtttgcttatca
ggtcgcggcgataaagatgttgttcaagttaaagaacgtcttgaagcagaaaaagaggtg
aaataa

DBGET integrated database retrieval system