KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1552Help
Entry
LACR_1552         CDS       T00420                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
llc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
llc01100  Metabolic pathways
llc01110  Biosynthesis of secondary metabolites
llc01130  Biosynthesis of antibiotics
llc01230  Biosynthesis of amino acids
Module
llc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LACR_1552
Enzymes [BR:llc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LACR_1552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C Polysacc_deac_2 AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ABJ73058
JGI: LACR1552
UniProt: Q02YB4
Position
complement(1469966..1470760)
Genome map
AA seq 264 aa AA seqDB search
MNIKEGKFLETILAEKKQEIAQMPDENSKPIRQTYRLYDYLKKHSDQLQVIAEVKKASPS
LGDINLEVDIIAQAKNYEQAGAAMISVLTDPVFFKGNIEYLREISKNVQIPTLNKDFIID
KKQINRALNAGATVILLIVACFENDFEKLEELYNYAISLGLEVLVETHNKAELDRAHQLA
AKIIGVNNRNLKTFEVSLQNSTDLVPYFKEENVYISESGIFGKKEAQKVAENFNGILVGT
ALMQANNLTKSLTDLKIKRKNDEH
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaacataaaagaaggaaaattcttagaaacaattttagcagaaaaaaaacaagagata
gctcaaatgcctgacgaaaattccaaaccaattcgtcaaacttatagattatatgattac
ctaaaaaaacattctgatcaacttcaagtcattgccgaagtaaaaaaagcttcgccaagt
cttggagatatcaatctcgaagtagacattatcgcccaagccaaaaattatgaacaagct
ggggctgccatgatttccgttctaactgaccctgtattctttaaaggaaacattgaatac
ctccgtgaaatatctaaaaatgttcaaattccaacacttaacaaagattttatcattgat
aaaaagcaaattaatcgagcactcaatgctggtgcaactgttattttattgattgtcgct
tgttttgaaaatgactttgaaaaattagaagaactctacaattatgcaatttcactagga
cttgaagttttagtcgaaacgcataataaggccgaactcgacagagcccatcaacttgct
gctaaaattattggggtcaataatcgtaatctaaagaccttcgaagtgagcttacaaaac
tcaacagatttggttccttattttaaagaagagaatgtttatatttctgaatcaggtatt
ttcggtaaaaaagaggcacaaaaagttgctgaaaatttcaatggaattttggttggaaca
gcactgatgcaagcaaataatctcacaaaatcactgacagatttaaaaatcaaaaggaaa
aatgatgaacattaa

DBGET integrated database retrieval system