KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1641Help
Entry
LACR_1641         CDS       T00420                                 

Definition
threonine dehydrogenase related Zn-dependent dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LACR_1641
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LACR_1641
  Lipid metabolism
   00071 Fatty acid degradation
    LACR_1641
  Amino acid metabolism
   00350 Tyrosine metabolism
    LACR_1641
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LACR_1641
   00626 Naphthalene degradation
    LACR_1641
Enzymes [BR:llc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LACR_1641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1551516..1552496)
Genome map
AA seq 326 aa AA seqDB search
MRSAYFVEKNKMEVREFPKAQLVKETDAIIKIVRACVCGSDLWWFRGISERQPGPVGHEA
IGVIEEVGAGVKNFKAGDFVIVPFTHGCGHCPICLAGFEANCPNAKDGVNGGYQGEFYRA
INADGALVKISGRPSDYSEEQLASLTTLADVMPTGFHAAKAADVHEGDTVVVFGDGAVGL
CAVISAKLLGAKRIIAMSRHEDRAALARDFGATDIIAERGAEAIQKIMAITNGYGADASL
ECVGTKEAIESAFQAVRAGGRVGRVGVPHDVDYNEWIDSLFWKNIQLGGGVASVARWDKE
ILLEAVLSGEIDPGRVFTEEFTLDEI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcagcctattttgtcgaaaaaaataagatggaagttagagaatttcccaaagcg
caacttgtaaaagaaacagatgccattataaaaatcgttcgtgcctgcgtttgtggttct
gatttatggtggttccgtgggatttctgaacgtcagccaggtccagtaggtcatgaggct
attggtgtcattgaagaagttggagcgggagttaaaaactttaaagcgggagattttgtc
attgttccctttactcatggttgtggacactgtccaatctgtttggcaggatttgaagct
aattgccccaatgctaaagatggagttaacgggggatatcaaggagaattctatcgagca
attaatgctgatggtgcacttgttaaaatttcaggaagaccaagtgattattcagaagaa
cagctggcttcgttgacaactttagcggatgtcatgcccacaggttttcatgcggctaaa
gcagcagatgtccacgaaggggacacagtagttgtctttggcgatggagcagtaggtctg
tgcgcagtgatttcggctaaacttttaggtgcaaaacggattattgcaatgagtcgccat
gaagatcgagcggcattggcgcgtgattttggggcaacagatatcattgctgagcgtggc
gcagaagcgattcaaaaaattatggccataaccaatggttatggtgctgatgcttcctta
gagtgtgtcggaacaaaagaagccattgaatctgctttccaagcagtaagagcgggagga
cgtgtaggtcgcgtgggagttcctcatgatgttgattacaatgaatggattgattctctt
ttttggaaaaatattcaacttggaggtggagtagcctctgtcgcacggtgggataaggaa
atcttacttgaagcagttttaagtggggagattgatccagggcgtgtctttacagaagaa
tttaccctagatgaaatttaa

DBGET integrated database retrieval system