KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1660Help
Entry
LACR_1660         CDS       T00420                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:llc00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1568718..1569563)
Genome map
AA seq 281 aa AA seqDB search
MKKQYEIISMKDHYRIRLGIFEPQEKAKGVVQLVHDFGEYTGHYLYLINELVNAGFVCFM
HDQRGHGVLAAAKPKLQGRARNYENFISDALEVRKIIGKRYPKLPVYLFGHSMGGNISLN
VLLRNVENQKLYQKAVIESPWLALTNPPAIPLQKLAQVLGKFNSKIRVRTGLKVDAISHR
SDLVDLVTKDGIYHELLSLRLFSQIMEAGRFAQSQAEQLKIPTLLFCGEEDQICSPLAIR
SFAENAGANLELVEVAEGYHALHLDTKADAFIDKMKAFLLE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacagtatgaaattatttcaatgaaagatcactatcggattcgtcttggaatt
tttgaaccacaagaaaaagcaaaaggcgtggtgcaattagttcatgattttggcgaatat
acgggtcattatttatatttaatcaatgaattagttaatgctggttttgtttgctttatg
cacgaccaaagaggacatggggttctagcagcagctaaacctaaacttcaaggacgagca
agaaattatgaaaactttattagtgatgccttagaagtccgaaaaataattggcaaaaga
tatcccaaattaccagtttatctcttcggacacagtatgggaggaaatatttcactgaat
gttctgctgagaaatgttgaaaatcaaaaactttatcaaaaagcagttattgaatctcct
tggcttgccttgacaaatccaccggctattcccctacaaaagttggctcaagttttagga
aaatttaattcaaaaattagagttcgtacgggacttaaagttgatgcaatctctcatcgg
agtgacttagttgatttagtgactaaagatggaatatatcatgaactattatctttacgt
ttgttttcacaaattatggaagcaggacgttttgcccaaagtcaggccgagcagttaaag
ataccgaccttattattttgtggagaagaagaccaaatttgttcaccgttagcgattcgt
tcctttgctgaaaatgctggtgctaatttggaattagttgaagttgctgagggctatcat
gcccttcatttagatactaaagcagatgcttttattgacaaaatgaaggctttcctgctt
gaataa

DBGET integrated database retrieval system