KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1802Help
Entry
LACR_1802         CDS       T00420                                 

Definition
ribokinase family sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LACR_1802
Enzymes [BR:llc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LACR_1802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1697021..1697941)
Genome map
AA seq 306 aa AA seqDB search
MTKVSVVGSISMDLVTSTKRVPQAGETVFGENFAMVPGGKGANQAVAFARLAPHDVNMIG
AVGNDAFGETILKNFKENAVLFDGVGTVPQTTGIAQITLFDDDNRIIIIPGANNEVLPDY
LENFWEKIKDSQLVVLQNEIPHETNLAVAKFCKENAIKVLYNPAPARKTDLEMIEFVDYI
TPNEHECKELFPNEPLEEILAKYANRLIVTLGSEGVIFHNGNGVQKILAIKAKVVDTTGA
GDTFNGSFAFGLTENLSIVDSIQLAVVASHLSIHKFGAQGGMPILAEVEDKLKELNLNFY
KEKKGL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagtaagtgttgtaggaagtatttccatggatttagtgacaagcacaaaaaga
gttccacaagcaggtgaaacagtttttggagaaaattttgcgatggttcctggtggcaag
ggagcaaatcaagccgttgcttttgctagattagctccccatgatgtaaatatgattgga
gcagttggaaatgatgcttttggagaaactattctaaaaaacttcaaagaaaatgctgtt
ctttttgatggtgtaggaacggtaccacaaacgacagggattgcccaaattactttattt
gatgacgataatcgaattatcattattcctggggccaataatgaagtcctccctgattat
ttagagaatttctgggagaaaattaaagacagtcaacttgtggttttacaaaatgaaata
cctcatgaaactaaccttgcagtcgctaaattttgtaaagaaaatgcgataaaagtcctt
tataatccagctccagcaagaaaaacggatttagaaatgattgaatttgtagattacatc
acgcctaatgaacacgaatgtaaggagctttttccgaatgagcctctggaggaaattctt
gctaaatatgcgaatcgcctgattgtcactttaggaagtgaaggagtgattttccataat
ggtaatggggttcaaaaaattctagcaattaaagctaaagtggtagatacgacgggagca
ggggatacattcaatggatcttttgcttttggactgacagaaaatctatcaatcgttgat
tctatccaattggcagtggttgcttcccatttatctattcataaatttggtgctcaaggt
ggaatgccaattctagcagaagttgaagataaattaaaagagcttaatcttaatttttat
aaggaaaagaaaggactttga

DBGET integrated database retrieval system