KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_1875Help
Entry
LACR_1875         CDS       T00420                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LACR_1875
   01230 Biosynthesis of amino acids
    LACR_1875
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LACR_1875
  Energy metabolism
   00680 Methane metabolism
    LACR_1875
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LACR_1875
Enzymes [BR:llc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LACR_1875
Exosome [BR:llc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LACR_1875
  Exosomal proteins of melanoma cells
   LACR_1875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1770305..1770886
Genome map
AA seq 193 aa AA seqDB search
MTEVYFIRHSLRDNATYDDMDVPLTAEGEKRALILADAFANVSIEQIFSSPFQRSVRTLN
PLAHSKNLEIQLISDLRERNVGHEIADFWPFAKRQWKDFDYKLADGESLREVQNRNISAL
EQILATSKNQKVAIGTHGTSLSTILNFYQPDFQFQDFLSLAGKMPYVIKMDFAENNYLTH
QVIEIDYDNKKSY
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtttattttattcgacattctcttagagataatgcaacctatgacgatatg
gatgttcctctgactgccgagggtgaaaaacgcgcactaatcttagctgatgcttttgca
aatgtatcaatcgagcaaattttttccagtccatttcaacgttctgttcgtaccctgaat
cctcttgctcactctaaaaatcttgaaattcaactcatttctgatttgagagaaagaaat
gttggccatgaaatagctgatttttggccttttgcaaagcgacaatggaaagattttgat
tataaacttgctgatggagaatccttacgtgaagttcaaaatcgtaatatttcagccctt
gaacagattttagcaacttctaaaaatcaaaaagttgcaatcggaactcatggtacttct
ctttctaccattttaaatttttatcaaccagactttcagtttcaagattttctatcttta
gctggcaaaatgccctatgtcatcaaaatggactttgctgaaaataattatctgacccac
caagtcattgaaattgattatgacaataaaaaaagttactga

DBGET integrated database retrieval system