KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_2309Help
Entry
LACR_2309         CDS       T00420                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LACR_2309
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LACR_2309
   00052 Galactose metabolism
    LACR_2309
   00500 Starch and sucrose metabolism
    LACR_2309
   00520 Amino sugar and nucleotide sugar metabolism
    LACR_2309
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LACR_2309
   00524 Butirosin and neomycin biosynthesis
    LACR_2309
Enzymes [BR:llc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LACR_2309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2154218..2155189
Genome map
AA seq 323 aa AA seqDB search
MTASKIIGIDLGGTSIKFGILTLTGEVQDKWSIPTNILEDGKHIVPDIIQSINHRLNLYN
LDKSEFLGIGMGTPGSVNISESTVKAAFNLNWADTQEVGKPISEGVGLPFILDNDANVAA
LGERWVGAGENNPDVVFITLGTGVGGGIIASGELVHGVAGAGGEIGHICVDPDGFECTCG
NRGCLETVTSATGIVRLARKFAEEYEGDSTIKAAIDNGDEVTSKDIFFAAQEGDHFSLSV
VDKFAYYLGFACANLGSTLNPASIVIGGGVSAAGEFLREKVETYFNKYAFSTVRNSSKIK
LAVLGNDAGIIGAASLALKFKGE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaagtaaaattatcggtatcgaccttggcggaacttcaattaaatttgggatt
ttaactctcactggtgaagttcaagataaatggtctatcccaacaaatattttagaagat
ggaaaacatatcgttcctgatattatccaatcaataaaccaccgtttgaacctttacaat
ttggataaatcagagtttcttggaattggaatgggaactcctggatcagtaaatatttct
gaaagtactgttaaagccgctttcaacttaaactgggcagacactcaagaggttggtaaa
ccaatttctgagggtgttggtctacctttcatcttggacaatgacgctaacgttgctgct
cttggtgaacgttgggttggggctggcgaaaacaatcctgatgtagtcttcatcactctt
ggaactggtgttggtggtggaattatcgcctcaggagagctagttcatggtgttgctgga
gctggtggtgaaatcggccacatttgcgttgaccctgatggttttgaatgtacttgtgga
aaccgcggttgtttggaaacagtaacttctgctacaggaatcgttcgcttagctcgtaaa
tttgctgaagagtacgaaggagattctactattaaggctgctattgacaatggtgatgaa
gtaacttctaaagacattttctttgctgctcaagaaggggaccacttcagcttatctgtt
gttgataaatttgcttattatcttggatttgcctgtgcaaatttgggttctactttaaac
cctgcttcaatcgttattggtggtggtgtatcagcagctggtgaattcttgcgtgaaaaa
gttgaaacttatttcaataaatatgccttttcaactgttcgtaactcaagtaaaattaaa
cttgctgttcttggaaatgatgccggaattatcggcgctgcaagtcttgctcttaaattt
aaaggagaataa

DBGET integrated database retrieval system