KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_2346Help
Entry
LACR_2346         CDS       T00420                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.24 6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:llc00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2192930..2194381)
Genome map
AA seq 483 aa AA seqDB search
MNKKIRVRYAPSPTGLLHIGNARTALFNYLFARHHGGDFIIRIEDTDRERHVEDGERSQL
ENLRWLGMDWDESPETHENYRQSERLPLYQKYIDQLLAEGKAYYSYKTPEELEADHAKQE
AAGIPPHYINEYAGMSDDEKAAYIAERKAQNIEPVVRISVDEKAIYKWNDIVKGEIEFEG
GNIGGDWVIQKRDGYPTYNFAVVVDDHDMQISHVIRGDDHIANTPKQLVVYDALGWEAPQ
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMSDAIFNFIALLGWNPGGEKEIFSR
EELIELFDENRLSKSPAAFDQKKLDWMDNEYIKNADFAKVFELTKPFLLAANRFDERAQE
LVKLYQPQMKSADEVVELTDLFYGDFPELTDEAREMLAAETTPLALSTFRAKLAELPESD
FTVENIFPLFKATQKETGVKGKMLWMPIRIAASGSMHGPELPETIALLGKEKVLAHLDAA
LNK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaaatccgcgtccgttacgcaccatcaccaacaggacttttgcatatcggg
aacgcccgtacagccctttttaactatctttttgcccgtcatcacgggggagatttcatc
atccgtattgaagatacagaccgtgaacgccatgttgaagatggtgaacgttcacaactt
gaaaaccttcgttggttgggaatggattgggatgaaagccctgaaacacacgaaaattat
cgtcaatcagaacgcttgcctttgtatcaaaaatatattgaccaattgttagctgagggt
aaagcttattattcttacaaaactcctgaagaactagaagctgaccatgctaaacaagaa
gcagcaggaattcccccacattatatcaatgaatatgctggcatgagcgatgacgaaaaa
gcagcttatattgctgaacgtaaagcacaaaatattgaacctgtcgttcgtatctctgtt
gacgaaaaagccatttataaatggaatgacatcgttaaaggtgaaattgaatttgaaggt
ggcaatatcggtggcgattgggttatccaaaaacgtgatggttacccaacttacaacttt
gctgttgttgttgatgaccacgatatgcaaatttcacatgtcattcgcggagacgaccat
attgccaatacgccaaaacaattggttgtttatgatgctttaggttgggaagcgccacaa
tttggtcacatgactttgattattaattctgaaacagggaaaaaattgtcaaaacgtgac
acaaacacactccaatttatcgaagactaccgtaaaaaaggctacatgtctgatgccatt
ttcaactttattgcacttttgggttggaatcctggtggagaaaaagaaattttctctcgt
gaagaattgattgaactttttgacgaaaatcgtttgtctaaatcaccagcagcctttgac
caaaagaaattggactggatggacaatgaatacatcaaaaatgccgattttgcgaaagtt
tttgaattgacaaaaccattccttcttgccgctaatcgctttgatgaacgtgcgcaagaa
ttggttaaactttatcaaccacaaatgaaatcagcagatgaggttgttgaattaacagac
cttttctacggagatttcccagaattgactgatgaagcacgcgaaatgttagctgctgaa
acaacaccacttgcattgagcactttccgtgcaaaattggctgaacttcctgaaagtgac
tttacggttgagaatattttcccactctttaaagccactcaaaaagaaacaggcgtgaaa
ggtaaaatgctctggatgccaatccgtattgcagcttcaggctcaatgcacggtccagaa
ttaccagaaacgattgctcttcttggaaaagaaaaggtattggctcacttggatgccgct
ttaaataaataa

DBGET integrated database retrieval system