KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_2405Help
Entry
LACR_2405         CDS       T00420                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LACR_2405
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LACR_2405
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LACR_2405
Enzymes [BR:llc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LACR_2405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2233247..2234737)
Genome map
AA seq 496 aa AA seqDB search
MVTFYQSTRDKSNKKTASQAILQGLAEDGGLFVPVDFPKVDLDFEKLKNASYQEIAELVL
KAFFDDFSADEIKSMVTKAYGEKFDSPEIAPLKRLGNHYILELFHGETIAFKDMALSILP
HLMTQAAKKNGVTNEIVILTATSGDTGKAAMAGFADVPQTKIIVFYPKGGVSHIQEQQML
TQKGANVHVVGIDGNFDQAQTAVKEMFNNKVLHDQLLKNNKQFSSANSMNIGRLIPQVAY
YIYAYAQLVKTGQITDGEKINFSVPTGNFGNILAAYYAKKLGLPVHQLICASNKNNVLTD
FFKTGLYDKNREFYVTSSPSMDILVSSNLERLIFDLTDENDDETLALLTALSAEGHYQIS
KKMMSKLQGFIADWASEEEISQEINETFENENYVLDPHTAVANYVYHQIQPKEKTVVVST
ASPYKFPKVVLEGLQKSGTDLSEKIDDFAAVKSLEKLSGIPLPKAVLGLEKAEILHHTVV
PVQEMQKEVEKYLGLK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggtaactttttatcaatcaacacgggataaatcaaataaaaaaacagcctcacaagct
atcttgcaaggtttggcagaagacggtggactttttgttcctgttgacttcccaaaagtt
gatttagactttgaaaaattaaaaaacgcttcttatcaagaaattgctgaacttgttttg
aaagcattttttgatgatttttctgctgacgaaattaaatcaatggttacaaaagcatac
ggagaaaaattcgatagtccggaaattgcaccgcttaaaagacttgggaatcactatatt
cttgaactttttcatggtgaaacgattgcttttaaagacatggcactctctatcttacct
catttaatgacccaagcggctaagaaaaatggtgtgaccaatgaaattgttatcttgact
gcaacttctggagatacaggaaaagccgcaatggctggttttgctgatgtgccccaaaca
aaaattattgttttttatcccaaaggtggtgtcagccatattcaagagcaacaaatgctg
acccaaaaaggggctaatgttcacgttgttggaattgatggaaattttgaccaagctcaa
acagcagtaaaagaaatgtttaataacaaagttttacatgatcaacttttgaaaaataat
aaacaattttcgtcagcaaattcaatgaatattggacgtttgattccgcaagtcgcttat
tatatttatgcttacgcacaactggtcaaaactggtcaaattactgacggagaaaaaatc
aatttttcagttccgacaggaaattttggaaatattttagccgcttattatgctaaaaaa
ttgggcttgcccgttcatcagctcatctgtgcttcaaataaaaataatgtgctgacagac
tttttcaaaacaggactttatgataaaaatcgagaattttatgtgacaagttcaccgtca
atggatattttggtttcttcaaatcttgaacgattgatttttgatttaactgacgagaat
gatgatgagactttggctttactgacagctttgtcagcagaaggtcattatcaaatttct
aaaaaaatgatgagtaagttacaaggttttatagctgactgggcatcagaagaagaaatt
tcccaagaaattaatgaaacttttgaaaatgaaaactatgttcttgacccccacacagcg
gttgcaaactatgtctatcatcaaattcaaccaaaagaaaaaacagttgttgtcagcact
gccagcccttataagttccctaaagttgttttagaaggacttcaaaagtcaggaacggac
ttgtcagagaagatagatgattttgctgccgttaaatcacttgaaaaactcagtggtatt
ccattacccaaagctgtgttagggcttgaaaaagctgaaattttgcatcatacagtagtt
ccagttcaggaaatgcaaaaagaagtagagaaataccttggtttaaaatga

DBGET integrated database retrieval system