KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_2457Help
Entry
LACR_2457         CDS       T00420                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LACR_2457
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LACR_2457
   00620 Pyruvate metabolism
    LACR_2457
   00650 Butanoate metabolism
    LACR_2457
  Lipid metabolism
   00071 Fatty acid degradation
    LACR_2457
  Amino acid metabolism
   00350 Tyrosine metabolism
    LACR_2457
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LACR_2457
   00626 Naphthalene degradation
    LACR_2457
Enzymes [BR:llc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LACR_2457
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LACR_2457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2289290..2292001
Genome map
AA seq 903 aa AA seqDB search
MATKKAAPAAKKVLSAEEKAAKFQEAVAYTDQLVKKAQAAVLKFEGYTQTQVDTIVAAMA
LAASKHSLELAHEAVNETGRGVVEDKDTKNHFASESVYNAIKNDKTVGVIAENKVAGSVE
IASPLGVLAGIVPTTNPTSTAIFKSLLAAKTRNAIVFAFHPQAQKCSSHAAKIVYDAAIE
AGAPEDFIQWIEVPSLDMTTALIQNRGIATILATGGPGMVNAALKSGNPSLGVGAGNGAV
YVDATANIDRAVEDLLLSKRFDNGMICATENSAVIDASIYDEFVAKMQAQGAYMVPKKDY
KAIESFVFVERAGEGFGVTGPVAGRSGQWIAEQAGVNVPKDKDVLLFELDKKNIGEALSS
EKLSPLLSIYKSETREEGIEIVRSLLAYQGAGHNAAIQIGAMDDPFVKEYGIKVEASRIL
VNQPDSIGGVGDIYTDAMRPSLTLGTGSWGKNSLSHNLSTYDLLNVKTVAKRRNRPQWVR
LPKEIYYEKNAISYLQELPHVHKAFIVADPGMVKFGFVDKVLEQLAIRPTQVETSIYGSV
QPDPTLSEAIAIARQMTQFEPDTVICLGGGSALDAGKIGRLIYEYDARGEADLSDDASLK
ELFQELAQKFVDIRKRIIKFYHPHKAQMVAIPTTSGTGSEVTPFAVITDDETHVKYPLAD
YQLTPQVAIVDPEFVMTVPKRTVSWSGIDAMSHALESYVSVMSSDYTKPISLQAIKLIFE
NLTESYHYDPAHPTKEGQKARENMHNAATLAGMAFANAFLGINHSLAHKIGGEFGLPHGL
AIAIAMPHVIKFNAVTGNVKRTPYPRYETYRAQEDYAEISRFMGFAGKEDSDEKAAKALV
AELKKLTDSIDINITLSGNGVDKAHLERELDKLADLVYDDQCTPANPRQPRIDEIKQLLL
DQY
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggcaactaaaaaagccgctccagctgcaaagaaagttttaagcgctgaagaaaaagcc
gcaaaattccaagaagctgtcgcttatactgatcaattagtcaaaaaagctcaagctgca
gttcttaaatttgaaggatacacacaaactcaagttgatactattgttgctgcaatggct
cttgcagcaagcaaacattctctggaactcgctcacgaagccgttaatgaaactggccgt
ggagttgttgaggacaaagatacaaaaaaccatttcgcttctgaatctgtttataatgca
atcaaaaatgataaaacagttggcgttatcgctgaaaacaaagttgctggttctgttgaa
atcgcaagcccccttggagtacttgctggtattgtcccaacaactaatccaacatcaaca
gccatctttaaatctttattggctgcaaagactcgtaatgctattgtctttgcctttcac
ccacaagcacaaaaatgctcaagccatgcagctaaaattgtttatgatgctgcgattgaa
gctggtgcacccgaagacttcattcaatggattgaagtacccagtcttgatatgacgact
gctttgattcaaaatagaggaattgctacaattcttgcaactggtggtccaggtatggtc
aatgctgcgcttaagtctggtaatccttcacttggtgtaggtgctggtaacggtgcagta
tacgttgatgcaactgcaaatatcgatcgtgctgttgaagatctcttgctttcaaaacgt
tttgataacggaatgatttgtgcgactgaaaactctgcagttattgatgcatcaatctat
gatgaatttgtcgctaaaatgcaagcccaaggcgcttatatggttcctaaaaaagattac
aaggcaattgaaagttttgttttcgttgaacgtgctggtgaaggttttggtgtaactggt
cctgttgctggtcgttctggtcaatggattgctgaacaagctggtgttaacgtccctaaa
gataaagatgttcttctttttgaacttgataagaaaaatattggggaagctctttcttct
gaaaaactttctcctttgctttcaatctacaaatcagaaacacgtgaagaaggaattgaa
attgtacgtagcttacttgcttaccaaggagctggtcacaacgctgccattcaaattggt
gcaatggacgacccatttgtcaaagaatacggaattaaagtcgaagcttctcgtatcctc
gttaaccaacctgactctatcggtggggtcggagatatttatactgatgcaatgcgtcca
tcattgacgctcggaactggttcatgggggaaaaattcactttcacacaatttgagtaca
tacgatctattgaatgttaaaacagtggctaaacgtcgtaatcgccctcaatgggttcgt
ttgccaaaagaaatttactacgaaaaaaatgcaatttcttacttacaagaattgccacac
gtccacaaagctttcattgttgccgaccctggtatggttaaattcggtttcgttgataaa
gttttggaacaacttgctatccgcccaactcaagttgaaacaagcatttatggctcagtc
caacctgacccaactttgagcgaagccattgcaatcgctcgtcaaatgacacaatttgaa
cctgacactgtcatctgtcttggtggtggctctgcccttgatgctggtaagattggacgt
ttgatttatgaatatgatgctcgtggtgaggctgacctttccgatgacgcaagtttgaaa
gagctcttccaagagttagctcaaaaatttgttgatattcgtaaacgtattatcaaattc
taccacccacacaaagcacaaatggttgctatccctactacttctggtactggttctgaa
gtgactccatttgcggttatcactgatgatgaaactcacgttaaatatccacttgctgac
tatcaattgacacctcaagttgccattgttgaccctgagtttgttatgactgtaccaaaa
cgtactgtttcttggtctgggattgatgccatgtcacacgcgcttgaatcttatgtttct
gtcatgtcttctgactatacaaaaccaatatcacttcaagccatcaaacttatctttgaa
aacttgactgagtcttatcactatgacccagctcatccaaccaaagaaggtcaaaaagct
cgcgaaaacatgcacaatgctgcaacactcgctggtatggccttcgccaatgctttcctt
ggaattaaccactcacttgctcataaaattggtggtgaatttggacttcctcatggtctt
gccattgctatcgctatgccacatgtcattaaatttaacgctgtaacaggaaacgttaaa
cgtaccccttacccacgttatgaaacttatcgtgcgcaagaagactacgctgaaatttca
cgcttcatgggatttgctggcaaagaagattcagatgaaaaagcggccaaagctttggtt
gctgaacttaaaaaattgactgatagtattgatattaatatcaccctttcaggaaatggt
gtagataaagctcatcttgaacgtgagcttgataaattggctgaccttgtttatgatgac
caatgtacacctgctaatccacgtcaaccaagaattgatgagattaaacaactcttgtta
gaccaatattaa

DBGET integrated database retrieval system