KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_2533Help
Entry
LACR_2533         CDS       T00420                                 

Definition
(GenBank) Asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Pathway
llc00250  Alanine, aspartate and glutamate metabolism
llc01100  Metabolic pathways
llc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LACR_2533
Enzymes [BR:llc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     LACR_2533
Peptidases [BR:llc01002]
 Cysteine Peptidases
  Family C44
   LACR_2533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700
Motif
Other DBs
NCBI-ProteinID: ABJ73961
JGI: LACR2533
UniProt: Q02VR1
Position
complement(2362979..2364856)
Genome map
AA seq 625 aa AA seqDB search
MCGIVGFIDRMDQNDKSKTLEEMMDTIAHRGPSSSGEFIDEGAAIGFRRLSIIDLEGGDQ
PIFNEDKTKLITFNGEIYNFRELREDLISKGHDFTTHADTEVLLHGYEEYGVELLQKLRG
MFAFVIWDREKQELFGARDHFGIKPLYYTQMNGTFMYGSEIKSFLKHPNFKKELNKEALK
PYMTFQYSALDETFFKNVFRIKEGHYFTYKDGVLDIKPYWDMKVDEKDMSLEESIDLIDK
TVLGSVDAHKFADVEVGAFVSSGVDSSYVASTLRPEHTYSIGFGQGTFNESKQAKQLTDM
IGLNNTSREIHGDEAFKYFPQIQYYLDEPDSNPSCVPLFFLAELAARDVRVVMSGEGADE
LFAGYESYGFSTNSRAVRVFAEGLKKLPKSLRFSIARGIENKHFKGQKHLYESLAPAEDF
FIGQAKVFDESESVELLKEEFQAALTVKEIVGKTYKKAPEGSELRKMQYLDMHQWMPGDI
LLKADKMAMAHSLELRVPLLDIELMHTAEQIPSKFLLNEHNTKYAFRQAARRHLPEEWSN
RKKLGFPVPIKDWLREEKYYKVVRQLFEQDFVAEFFDQEKLLKMLDDNFADKNDARRKLW
TIYSFLTWYDVYFINNGEKPAVVNF
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgtcggctttattgaccggatggatcaaaatgataaatcaaaaacttta
gaagaaatgatggatacaatcgctcaccgaggtccaagtagttcaggtgaatttattgac
gaaggagcagcaattggttttcgtcgcctgagtattattgaccttgagggtggagatcaa
cctatctttaatgaagataaaactaaacttataacctttaatggcgaaatttataatttc
cgtgaattgcgtgaagaccttatctctaaaggtcatgattttactactcatgctgataca
gaagtgcttttacatggttacgaagaatacggtgtagagcttcttcaaaaacttcgtgga
atgtttgctttcgtgatttgggatagagaaaaacaagaattgtttggtgcacgcgatcat
ttcgggatcaagcctctttactatactcaaatgaacggaactttcatgtatggttctgaa
attaaaagctttttgaaacatccaaacttcaaaaaagaattaaataaagaagctttgaaa
ccttatatgactttccaatattctgctcttgatgaaactttctttaaaaatgtttttcgt
atcaaagaaggacactactttacatataaagatggggttttagatattaagccttattgg
gatatgaaagttgatgaaaaagatatgagcttggaagaatcaattgatttgattgataag
accgttttgggttctgttgatgctcataagttcgctgatgttgaagtgggtgcttttgta
tcaagtggtgtagattctagttatgttgcttcaacgcttcgtcctgaacacacttattct
attggtttcggtcaaggaactttcaatgagtctaaacaagccaaacaattaactgatatg
attggtttgaataatacttctcgtgaaattcatggggacgaagcttttaaatatttccca
caaattcaatattatttagatgaaccagattcaaatccttcttgtgttcctctctttttc
cttgctgaattggcagctcgtgatgtacgggttgtaatgagtggtgaaggagcagatgag
ctctttgctggttatgagtcttatggatttagtaccaattctcgcgcggttcgtgttttt
gcagaaggtttgaagaaattaccaaaatctttacgtttctcaattgctcgtggaattgaa
aataaacatttcaaaggacaaaagcatctatatgaatcacttgcaccagctgaggacttc
ttcatcgggcaagcaaaagtatttgatgagtctgaatcagttgagcttttgaaagaagaa
tttcaagcggctctaacagtcaaagaaattgttggaaaaacttataaaaaagcaccagaa
ggttctgaacttcgtaaaatgcaatatcttgatatgcaccaatggatgccaggagatatc
ttgcttaaagcagataaaatggctatggcacattcacttgaattacgtgtcccattgtta
gacattgaattgatgcacacagccgaacaaattccttctaaattccttttgaatgaacac
aatacaaaatatgctttccgtcaagcagctcgtcgtcatttgccagaagaatggtcaaat
cgtaaaaaattgggattcccagtgccaattaaagactggttaagggaagagaagtattat
aaagttgttcgtcaattgtttgaacaagactttgttgcagaatttttcgaccaagaaaaa
cttttgaagatgttggatgataactttgcagataaaaatgatgctcgtcgtaaactctgg
acaatttattcattcttgacttggtatgatgtttacttcatcaataatggtgaaaaacct
gctgtggttaatttttaa

DBGET integrated database retrieval system