KEGG   Lactococcus lactis subsp. cremoris SK11: LACR_2573Help
Entry
LACR_2573         CDS       T00420                                 

Definition
hypothetical protein
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
llc  Lactococcus lactis subsp. cremoris SK11
Brite
Enzymes [BR:llc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     LACR_2573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2402572..2405292)
Genome map
AA seq 906 aa AA seqDB search
MVKAKKSTANIRHFPLVEQAEVAEKDLFDAHQGYTIPDYINSNLIHTLRYYQDEAVRNYH
YTQTRIKPSPQHVLFNMATGSGKTDLMAGLILYLYQEYDYKNFLFTVNTNSVLMKTKDNL
VNQNSDKYLFQDKIEIDGRQISILEVERFPRVQQDNTIYIKLSSVQKVSDDLFVVKENAM
GLADYERQPVVVLADEAHHYSASTKTEKESENTWESAINKILNARNEQEQKNLLLEFTAT
VDFDKEVIYDKYRDKVVYRYPLSKFMFDGYSKQVKRIETSASDEDKMLNVVLLSQFRKYR
AYLEGVTSTFKPVILFKSPKVAVSLEANKIFNQLIENLNVRELITFIKRQQLMDSNASSA
LSLAYDFYLKNEDQLGKIIREIKHDFDSRNVLNANDTSGNMLEKGQYQALNTLENPNNLY
RVVFAVAKLTEGWDVLNLYDIVRIEKEAGTNKSATMAEAQLIGRGARYYPFEIEGQKSYQ
RRFDNDSSNKQLFLETLHYHTMNEPQYLKQLVGSLKQMDLPTGEDKKNPPIEIKVKSSFK
KTEAYKKGKIYYNEVVDVEDEWFDSIDKYGINHQTDISRNLNYGSREVSYQANAGVTETK
TISVGRFDARYIKKAIQRLEFYQFDNLKKYMPLMPSMKEFIYGKNWLNANELNLFLTVPK
DYKSTDVTPDDILNVVIELLKEYEVKFKSGYVKQRGTNKFIGYPINEYLTNYNKRVPEYD
TANLFNEAMQKIAVYEIDDDFYVYEKAIVNKLEYELIERVKAHVNELKEKYQKSVYLLRM
DENMHRESAKSEKVKLHQYGSRRDRSGEITETHLQGFQPDFILFLENSDFYFQIFIEPKG
MSGDRFISELWKQDLLLYMTDNQAEMEFEANEQNVRISGLKFYTKNDGQHTMEQLANLVQ
IKKPVE
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagcaaaaaaaagtacagctaatatccgtcacttccctctagtagaacaagca
gaagtagcagagaaagatttgtttgatgctcatcaagggtataccattcctgattatatt
aattccaatttaattcatacgctaaggtactatcaagatgaagcagtacgaaactatcat
tatacacagacgcgaataaaaccaagtccacaacacgtcttatttaatatggcaacaggt
tctgggaaaacagacttgatggcgggcttaattttatatctctatcaagaatatgattat
aaaaacttcttatttacggtgaatacgaactctgttttgatgaaaacaaaagataacttg
gtgaatcagaatagtgataagtatctttttcaagacaagatagaaattgatggcagacag
atttctattttagaagtagaacgatttcctagagtccaacaagacaatacaatttatatt
aaactatcctcggttcaaaaggtttcagatgacttatttgttgttaaagaaaatgcaatg
gggttagctgactatgaacgtcagccagttgttgttttagctgatgaagcccatcactat
tccgcaagtactaagactgaaaaagaatcagaaaacacttgggaatcagccatcaataaa
attctaaatgcaagaaatgaacaagaacaaaaaaacttacttttggaatttactgcgacg
gtcgattttgataaagaagtgatttatgataaatatcgtgacaaggttgtttaccgttat
ccactaagtaaatttatgtttgatggctattcaaagcaagtcaaacgaattgaaacgtct
gcaagtgatgaagataaaatgttgaatgttgtcttattatcacagtttaggaaatatcga
gcctatttagaaggagtcacatctacatttaaaccagtgatactatttaaatcgccaaaa
gtggctgtttcactagaagcgaataaaatattcaatcaactcattgaaaatttgaatgta
agagagttaattacatttattaaacgccagcaactaatggatagtaatgcgagttcagca
ttgagtttagcctatgatttttatcttaaaaatgaagatcaacttggaaaaattattcga
gagattaaacatgattttgattctagaaatgtattaaatgcaaacgatacgagtggaaat
atgcttgaaaaaggacagtatcaagcattgaatacgttggaaaatcccaataatttgtat
cgtgttgtctttgcagtagccaagctaacggaagggtgggatgttcttaatctgtatgat
attgttcgtatagaaaaagaagcaggaacgaataaaagtgcaacgatggctgaagctcaa
ctaattggtcgtggtgctagatattatccatttgaaatagaaggacagaaaagttatcaa
agaagatttgataatgattcgtccaacaagcaactttttcttgaaacgttgcattatcat
acgatgaatgaaccacaatatctcaaacagttggtcggttcactaaaacaaatggattta
cctacaggagaagataaaaaaaatccccctattgaaattaaagtgaagtcatcctttaaa
aaaacagaagcctataaaaaaggaaagatttattacaatgaagtggtggatgtggaagat
gaatggtttgattcgattgataagtatggtattaatcatcaaacagatatatcaaggaat
ctgaattatggtagtcgagaggtttcatatcaagcaaatgcaggtgtgactgaaacaaaa
acaattagcgtgggtcgatttgatgcaaggtatataaaaaaagccattcaacgtttagaa
ttctatcaatttgacaatttaaagaaatacatgccattaatgccatcaatgaaagaattt
atttatggtaagaattggttgaacgcaaatgaattaaacttatttttaaccgtaccaaaa
gattacaaatcaactgatgttacaccagatgatatattgaacgttgtaattgaactctta
aaagaatatgaagtgaaatttaaatcaggttacgtaaaacaaagaggaacgaataaattt
atcggttatccaatcaatgagtatttaacaaattataataagcgtgttccagaatatgat
acagctaatctatttaatgaagcgatgcaaaaaattgccgtttatgaaatagatgatgat
ttttatgtttatgagaaagctatcgtgaataaactagaatatgagttgatagaacgtgtg
aaagcacatgttaatgaattgaaagagaagtatcaaaaatcggtgtatttgcttcgtatg
gatgagaatatgcatcgggaatctgcgaaaagtgagaaggtgaaactccatcaatacggt
tcacgtagagaccgttcaggagagatcacagaaacacacttacaaggttttcaacctgac
tttattttattccttgagaatagtgatttttattttcaaatctttatcgaaccaaaaggt
atgagtggggatcgatttattagtgaattatggaaacaagatttactcttatatatgaca
gataaccaagcggagatggaatttgaagcgaatgaacaaaatgtccgaattagcggattg
aaattctatacaaagaatgatggacaacacactatggaacaactagctaatttagttcaa
ataaaaaaaccagtagaataa

DBGET integrated database retrieval system