KEGG   Lactococcus lactis subsp. lactis KLDS 4.0325: P620_02215Help
Entry
P620_02215        CDS       T02882                                 

Definition
5-hydroxymethyluracil DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lld  Lactococcus lactis subsp. lactis KLDS 4.0325
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lld03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
406755..407573
Genome map
AA seq 272 aa AA seqDB search
MPELPEVETVRRELEKRIVGQKIVSIEATYPRMVLTGFKQLKKKLTGKTIHGISRRGKYL
IFEIGEKDRLISHLRMEGKYRLASLNVPMEKHDHLALKFTDEQLIYADVRKFGTWELIST
DQVLPYFLKKNIGPEPTYETFDEQIFREKLQKSTKKIKPFLLEQTLVAGLGNIYVDEVLW
LAKIHPEKVANQLTESSIHLLHDSIIEILQKAIKLGGSSIRTYSALGSTGKMQDELRVYG
KTGEKCVRCGNEIQKIKVAGRGTHFCPFCQQK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgccagagttaccagaagttgaaacagtgagaagagagcttgaaaaaagaattgttgga
caaaaaattgtatctatagaagccacttatccaagaatggttttaactggttttaagcaa
ttgaaaaaaaaattgacaggaaaaaccattcatggcatttcacgtcgcggaaaatattta
atttttgaaattggcgagaaagatcgtttgatttctcatctgcggatggaaggaaaatat
cgacttgcaagtctcaatgttccaatggaaaaacatgaccatttagcccttaaatttact
gacgaacaattaatttatgctgacgtaagaaaatttgggacttgggaactgatttctact
gaccaagtccttccatattttttgaagaaaaacattggtccggagccaacttatgaaact
tttgatgaacagattttccgagaaaaattgcagaaatcgacaaagaaaattaaacctttt
ctacttgaacaaacattagtggctggacttggaaatatttacgttgatgaagtgctctgg
ctagcaaagattcatccagaaaaagtggcaaatcaactgacagaaagttctattcatctt
ttacatgattctatcattgaaattttgcaaaaagcaattaaattaggcggctcaagcatc
agaacttatagtgccttaggttcaacaggaaaaatgcaggacgaattacgagtgtatgga
aaaacaggggaaaaatgtgtgcgttgtggcaatgaaattcaaaaaataaaagtggctggt
cgggggacccacttttgcccattctgtcagcaaaaataa

DBGET integrated database retrieval system