KEGG   Lactococcus lactis subsp. lactis KLDS 4.0325: P620_07100Help
Entry
P620_07100        CDS       T02882                                 

Definition
cytochrome C oxidase subunit II
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
lld  Lactococcus lactis subsp. lactis KLDS 4.0325
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lld00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    P620_07100
Enzymes [BR:lld01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     P620_07100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1364526..1366001
Genome map
AA seq 491 aa AA seqDB search
MKTILQAFEWYLPSDSQHWNNIKENIPDLGKLGFSGLWLPPASKAASGVEDVGYGTYDLF
DLGEFDQKGTIPTKYGTKDEYLDLINTLHHNNIEVYADIVFNHIMGADETETIEADIKAE
DNHLHNIENNKTVEVWTKFTFPGRQGKYDNYIWTWHNFTGIDYDERKNQEEILEFEGHEW
DENVDSENNNFDYLMGADLDFSVSETVEQLEKWGHWFSEMTKIDGFRLDAIKHIDFKYFD
KWLEQRAKQLDRKLFIVGEYWSDDLGKLEYYLEQSSDRIQLFDVPLHFNMKEASSTNGEF
DMRTLFDHTLTASQPELSVTFVDNHDTQEGQALQSWIPAWFKEHAYSLILLLKKGTPTVF
WGDLYGIPSHNVNPVGDNLRTMIALRKDSEFLRENDYFDHPDIIGWTNILKIDNKEYGLS
CILTNKNGGSKYMIIDKAYAGKVYIDLFGRHEIPITLDQNGGAEFYVNDGSVSVWVDKEI
VSKIDQMNFQN
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatccttcaagcttttgaatggtatttaccctcagattctcagcactggaat
aatataaaagagaatattcctgacttgggaaagttaggattttcaggattgtggttacct
ccagcttccaaggcagcttctggagttgaagatgttggttatgggacctatgatttattc
gacttaggggaatttgatcaaaaagggacaattcctacaaaatatgggactaaagatgaa
tatcttgatttaattaatacactacaccacaacaatattgaagtgtatgcggatatcgtt
tttaatcacattatgggtgctgatgaaacagaaactattgaagctgatattaaagcagaa
gataatcatcttcataacatcgaaaataataaaactgttgaagtttggaccaaatttaca
tttccaggaagacaaggaaaatacgacaattatatatggacctggcacaactttacggga
attgattatgatgaaaggaaaaatcaagaagaaattcttgaatttgaaggacatgaatgg
gatgagaatgtagattcagagaataataattttgattatttaatgggggctgatcttgat
tttagtgtttcggaaacggtagaacaacttgaaaaatggggacattggttttcagaaatg
acaaaaattgatggttttcgattagatgcaattaaacatattgatttcaaatattttgat
aaatggcttgagcagagagcaaagcaattggatagaaaactttttattgttggcgagtac
tggtctgatgatcttggcaaattagagtattatctagaacaatccagtgatagaatacaa
ttatttgatgtaccactacattttaatatgaaagaagcctcttcaaccaatggagaattt
gatatgcgtactctttttgatcacacactcactgccagccagccagaactctcggtcact
tttgttgataaccatgatactcaagaaggacaggctcttcaatcttggattccagcttgg
tttaaagagcacgcttatagcttaattttacttctaaaaaaaggaactcctactgtcttt
tggggagatttatatggaataccctcacataatgttaatcctgtaggtgataacttaaga
actatgatagcattacgtaaggactctgagtttttaagggaaaatgattattttgatcat
cctgatattattggatggacaaatattttaaaaatagataataaggaatatggattatca
tgtattttaactaataaaaatggtggctcaaaatatatgataattgataaggcgtatgca
ggtaaagtttatatagatttatttggaagacacgaaatacctattacgctggatcaaaat
ggtggagctgaattttatgtcaatgatggaagtgtttcggtttgggtagataaggaaatt
gtttcaaaaattgatcaaatgaactttcaaaactaa

DBGET integrated database retrieval system