KEGG   Lactococcus lactis subsp. lactis KLDS 4.0325: P620_07300Help
Entry
P620_07300        CDS       T02882                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lld  Lactococcus lactis subsp. lactis KLDS 4.0325
Pathway
lld00250  Alanine, aspartate and glutamate metabolism
lld00430  Taurine and hypotaurine metabolism
lld00650  Butanoate metabolism
lld01100  Metabolic pathways
lld01110  Biosynthesis of secondary metabolites
lld01120  Microbial metabolism in diverse environments
lld02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lld00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    P620_07300
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    P620_07300
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    P620_07300
   00430 Taurine and hypotaurine metabolism
    P620_07300
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    P620_07300
Enzymes [BR:lld01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     P620_07300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGY44310
UniProt: U5PPT5
Position
complement(1410917..1412317)
Genome map
AA seq 466 aa AA seqDB search
MLYGKENRDEAEFLEPIFGSESEQVDLPKYKLAQQSIEPRVAYQLVQDEMLDEGNARLNL
ATFCQTYMEPEAVKLMSQTLEKNAIDKSEYPRTTEIENRCVNMIADLWNASEKEKFMGTS
TIGSSEACMLGGMAMKFSWRKRAEKLGLDINAKKPNLVISSGYQVCWEKFCVYWDIEMRE
VPMDKEHMSINLDKVMDYVDEYTIGVVGIMGITYTGRYDDIKALDNLIEEYNKQTDYKVY
IHVDAASGGLYAPFVEPELEWDFRLKNVISINTSGHKYGLVYPGVGWVLWRDKKYLPEEL
IFKVSYLGGELPTMAINFSHSASQLIGQYYNFVRYGFDGYKAIHERTHKVAMFLAKEIEK
TGMFEIMNDGSQLPIVCYKLKEDSNRGWNLYDLADRLLMKGWQVPAYPLPKNLENEIIQR
LVIRADFGMNMAFNYVQDMQEAIEALNKAHILYHEEPENKTYGFTH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgttatacggaaaagaaaatcgcgatgaagcagagttcttggaaccaatttttggttca
gaaagtgaacaagtggatttgcctaaatataaattagctcaacaatcaattgaacctcga
gtggcctatcagttagttcaagatgaaatgttagatgaagggaacgctcgtttaaattta
gccacattctgtcaaacttatatggaacctgaagcagtcaaactaatgagtcaaaccttg
gaaaaaaatgcaattgataaatcggaatatccaagaacaactgaaattgaaaaccgttgc
gtcaacatgatcgctgacctttggaatgcgagtgaaaaagaaaaatttatggggacttca
acgattggttcttcagaagcttgtatgcttggtggaatggccatgaagttttcttggcgc
aagcgagcagaaaaattgggattagatattaatgcgaaaaagccaaacttagttatttca
tctggttatcaagtttgctgggaaaaattctgtgtttattgggatattgaaatgcgagaa
gtgccaatggataaagaacatatgtcaatcaatttggacaaggtgatggattatgttgat
gagtacacgattggtgtagttggtattatggggattacttatactggtcgttatgatgat
atcaaagctttggataatttaattgaagaatataataaacagacagactataaagtttat
attcacgtagatgctgcttcaggaggactttatgctccctttgttgagccagaacttgag
tgggatttccgtttgaaaaatgtcatttcaatcaatacctcaggccataaatatggttta
gtttatcctggtgtaggttgggttttgtggcgtgacaaaaaatatttaccagaagaatta
atttttaaagtaagttatcttggaggagaactaccaacgatggccattaatttttctcat
agtgcctctcaattaattggtcaatattataattttgtacgttatggatttgatggatat
aaagctattcatgagagaacacataaagtagccatgtttttagcaaaagaaattgaaaaa
actggaatgtttgaaattatgaacgatgggtcacaattgccaattgtctgctataaatta
aaagaagattcaaatcgaggttggaatctttatgatttggcggaccgtttattaatgaag
ggatggcaagtgcctgcttatccacttcccaaaaatttggaaaatgaaatcattcaacgt
ttagtgattcgagcagattttgggatgaatatggcatttaactatgttcaagatatgcaa
gaagcaattgaggctttaaataaggctcatattctatatcatgaagagcctgaaaataaa
acatatggatttactcactaa

DBGET integrated database retrieval system