KEGG   Lactococcus lactis subsp. lactis KLDS 4.0325: P620_09225Help
Entry
P620_09225        CDS       T02882                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lld  Lactococcus lactis subsp. lactis KLDS 4.0325
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lld00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    P620_09225
Enzymes [BR:lld01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     P620_09225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1793435..1794337)
Genome map
AA seq 300 aa AA seqDB search
MTKVSVIGSISMDLVTRTNRVPNAGETVFGEDFAMVPGGKGANQAVAFARLSPNEVSMIG
AVGKDAFGESILQNFKENAVLFENAGTVPQTTGIAQITLYDDDNRIIIIPGANNEVLPSY
LADLWEKIKESQLVILQNEIPHETNLAIAKFCKENAIKVLYNPAPARKTDLEMIDFVDYI
TPNEHECKELFPNLALEEILKKYSNRLIVTLGSEGVIFHDGETLQKIPAIKAKVVDTTGA
GDTFNGAFAFGLTENLSISDSIRLAVVASHLSIQKFGAQGGMPKLSEVKAKLKELEINLY
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagtaagtgttataggaagtatttcaatggatttagtcacaaggactaaccga
gtgccgaatgctggagaaacagtatttggtgaagatttcgctatggttcccggtggaaaa
ggagcgaaccaagccgttgcttttgccagactttctcccaatgaagtaagtatgattgga
gcagtaggcaaggatgcttttggtgagagtattttgcaaaacttcaaagaaaatgcagtt
ctttttgaaaatgcgggaacggtaccacaaacaacaggaattgctcaaattactctctat
gatgacgataatcgtattattattattccaggtgctaataatgaagttctaccaagttat
ctagcagacctttgggagaaaattaaagaaagccaacttgttattctacaaaatgaaatt
ccacatgaaacaaatctagcgattgctaaattctgtaaagaaaatgcgataaaagttctt
tataatccagctccagcaagaaaaacagatttggaaatgattgattttgttgattatatc
acaccgaatgaacacgaatgtaaggaactttttccaaatttagcacttgaagaaattctc
aaaaaatattcaaatcgtctgattgtcaccttaggaagtgaaggagtcattttccacgat
ggagagactcttcaaaaaattcctgccataaaagctaaagttgtagatacaactggtgca
ggagatacattcaacggagcctttgcctttggtttgactgagaacttatcaattagtgat
tctatcagattagctgtcgttgcttctcatttatctattcaaaaatttggcgcacaaggc
gggatgccaaagctatcagaagttaaagcaaaattaaaagaacttgaaattaatctctac
taa

DBGET integrated database retrieval system