KEGG   Lactococcus lactis subsp. lactis KLDS 4.0325: P620_12180Help
Entry
P620_12180        CDS       T02882                                 

Definition
penicillin-binding protein 2A
Orthology
K12555  
penicillin-binding protein 2A [EC:2.4.1.129 2.3.2.-]
Organism
lld  Lactococcus lactis subsp. lactis KLDS 4.0325
Pathway
beta-Lactam resistance
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lld00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    P620_12180
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    P620_12180
Enzymes [BR:lld01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     P620_12180
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     P620_12180
Glycosyltransferases [BR:lld01003]
 Polysaccharide
  Bacterial polysaccharide
   P620_12180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2329813..2332044)
Genome map
AA seq 743 aa AA seqDB search
MSENNNFSRRNKKESKKNSLKIPNLRPKKQKKLEEEIEKPAKTKFGKFMKPIKRFWKRYN
LTKITIIFVLVAIVSTGSYLFYLAKTANVKVLQSSISAQTVIYDKDNNEAGNLYGQKGTP
VKIDQISKNITNAVVATEDRTFYKNHGVNLKRFALAAVTLGRFGGGSTITQQLAKNAYLT
QEQTIDRKAREFFLALEINKHYSKDEILDMYLNNSYFGNGVWGIQDAALKYFGVPASEVT
VDEAASLAGMLKGPEIYNPLYEKGKYATDRRNTVLQNMVNAGYLEQSQADTFMKVDLQAQ
LQDNYQSKSSQYKYPSYYNAVISEAERKYGLTLQEIMNNGYKIYTGMDQNMQSGLQKTYS
DPSFFPQASDGTYAQSASVAIDPKTGAVNALVGNVNTEGSNSFTDYNYATMSKRSPGSVI
KPLIVYAPAIEAGWSIDKTVDDSPADYNGWKPTDFDNQWRGQIPMYTALANSYNIPAINT
YQAIGPKVGNALGREFGLDLSSKNDVLPTALGAGVETNPWQIAQAYQVFANGGVMNDAHL
ITKIENAAGQVVKTAKVTKKRVISKDTADKMTQMMLGTYTNGSAWKASPKSYTLAGKTGT
NEDQDQWVVGYTPDVVMALWVGYADGKYKLTGSSEGQTSVIFRQEASYMLPYTKGTAFTV
ENPYAEAGVAAQEPYWTQQRQYQDDIVDQEQAEAHTTGNTPESSSSSSSSSSDSGGLDLG
KVGKDIGDAAKNAWDKVKGIFGN
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaataataatttcagtcggcgtaataaaaaggaatctaaaaaaaatagttta
aaaattcctaatttacgccctaaaaaacaaaaaaagcttgaagaagaaatagaaaaaccg
gctaaaacgaagttcggtaaattcatgaaaccaattaaacggttctggaaacgttataat
ctgacaaaaatcacaattatttttgtcttagtagccattgtttcgacaggttcatatctt
ttttacttagctaaaacagctaatgttaaagtactgcaaagttctatttcggcacaaaca
gtcatttatgacaaagataataatgaagctggaaatctttatggtcaaaaaggaacaccg
gtcaagattgaccaaatttccaaaaatattacaaatgctgttgtggcaactgaagataga
actttctataaaaatcatggtgtcaatttgaaacgttttgctctagcagccgttactctt
gggcgttttggtggtggttcaacaatcactcagcaattggccaaaaatgcttatttgact
caagaacaaacgattgaccgtaaagcgcgtgagtttttcttggcacttgaaatcaataaa
cattatagtaaagatgagattcttgatatgtatctgaataattcttactttggtaatggt
gtttggggaattcaggatgcagctttgaaatactttggtgttccagcaagtgaagtaact
gttgatgaagcagccagtcttgcgggaatgttaaaagggccagaaatttataatcctctt
tacgaaaaaggaaaatatgcgactgaccgacgtaatacagttttgcaaaatatggttaat
gctggttatttggagcagtcacaggcagatacttttatgaaagttgacttacaagctcaa
ttgcaagacaattatcaatctaaaagtagtcaatataaatatccaagctattataatgct
gtaatttctgaagcggaacgcaagtatggtctgacattacaagaaatcatgaataatggt
tacaagatatatacgggcatggaccaaaatatgcaatccggtttgcaaaagacttattct
gacccaagtttcttcccacaagcatctgatggaacttatgcccaatctgcttcggttgct
attgaccctaaaacgggagctgtcaatgctcttgtcggaaatgttaatacagaaggttca
aatagctttactgattataactatgccacaatgtctaaacgttctcctggttcagttatc
aaacctcttattgtttacgctccagcaattgaagcggggtggtcaattgataaaacggtt
gatgattcaccagcagattataatggctggaaaccaaccgattttgataatcaatggcgt
ggacaaatcccaatgtatactgctttagcaaattcatataatattccagctattaataca
tatcaagcgattggaccaaaagtcggaaatgctttagggcgtgagtttggtttagattta
agtagtaaaaatgatgttttaccgacggcactcggagctggagttgaaacgaatccatgg
caaattgctcaggcttatcaagttttcgcaaatggcggagtgatgaatgatgcgcatttg
attactaaaattgaaaatgctgcaggacaagttgtaaaaacagcaaaggtaaccaaaaaa
cgggttattagtaaagatacagctgacaaaatgactcaaatgatgctggggacttatact
aatggttctgcttggaaagcttcacctaagtcttatacacttgctggtaagacaggaacc
aatgaagaccaagaccaatgggtagtaggttatacaccggatgtggttatggctctctgg
gttggttatgcggatgggaaatataaactgacaggttcatcagaaggacaaacctcagtc
attttccgtcaagaagctagttatatgttgccttatactaaaggaacggcatttacagtt
gaaaatccttatgcggaagcaggtgttgccgcacaagaaccttattggactcaacaaaga
caatatcaagatgatattgtggaccaagaacaagcagaggctcacacgactggaaataca
ccagaaagctctagttctagctcttcatcgtcttcagattctggtggtttggacctcgga
aaagtgggtaaagatattggagatgcagctaaaaatgcttgggataaagttaaaggaatt
tttggcaactaa

DBGET integrated database retrieval system