KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_0172Help
Entry
uc509_0172        CDS       T02415                                 

Gene name
bglS
Definition
Beta-glucosidase A
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    uc509_0172 (bglS)
Enzymes [BR:lli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     uc509_0172 (bglS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
174080..175516
Genome map
AA seq 478 aa AA seqDB search
MEHKKLKAFPNDFLWGSASAAYQVEGAPFEDGKKASVWDNFVRIPGKTFKGTNGDVAVDH
YHRYKEDVALIKELGLKSYRFSIAWTRILPDGRGEVNQAGLKFYEDLIDELIANEIEPIV
TIYHWDLPQALEDLYGGWESREIIADFVNYAEVLFKAFKGKVKYWVSLNEQNIFTSQGWS
LATHPPGKRDMKLFYQVNHIANLTNAAVINKFHELEIDGQIGPSFSYTPQYAKDSDPLNV
LAAENEEELYSHFWMDVYLYGEYPIAAMAYLRENGLAPEFEAGDAELLKSAKPDFLGINY
YQTATNAWNPVDGGVGVGSFNTSGKKGTTKESGIPGLHKKIQNPFIDRTNWDWEIDPEGL
RIALRRITSRYRIPVMITENGLGEYDKVEDGKIHDDYRIKYLESHVKAIKEAMTDGAKVI
GYHTWSYTDLLSWLNGYQKRYGFVYVDQDETMEGSLKRIPKDSYYWYQHLIETNAEEV
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggagcacaaaaaattaaaagcatttccaaatgattttctatggggttcggcttcggca
gcctatcaagttgagggagcaccttttgaagatggcaaaaaagccagtgtctgggataat
tttgtccgtattccaggcaagacttttaaaggaacgaatggggatgtcgctgttgatcat
tatcatcgctataaagaagatgtggctttaattaaagagttgggccttaaatcctaccgt
ttttcaattgcttggacgcggattttacctgacggacgtggcgaagtcaatcaagcaggc
ttgaaattctatgaagatttgattgatgagttgattgctaatgagattgaaccaattgtc
acgatttatcattgggatttgccccaagccttagaagatttatatggtggttgggaatca
cgagaaattatcgcagattttgttaactatgctgaagttttgtttaaagctttcaaaggt
aaagtaaaatattgggtatcgcttaatgaacaaaatatttttacaagtcaaggttggtca
ctcgcgactcacccacctggaaaaagagatatgaaacttttttatcaggtcaatcatatt
gctaatctgacaaatgctgcggtaatcaataaatttcatgaacttgaaatagatgggcaa
attggcccttcgttttcctatacgccacaatatgctaaggattctgacccactcaatgtt
ttagcggctgaaaatgaagaagagctttatagtcacttttggatggatgtttatctttac
ggagaatacccaattgcggcaatggcttatttacgtgaaaatgggctagcacctgaattt
gaagcaggggatgctgaacttttgaaatcagctaaacctgattttctaggtattaattat
taccagacagctactaacgcatggaatccagttgacggaggagttggagtcggttccttt
aatacaagtggtaaaaaaggaacaaccaaagaatcaggaattccaggcctccataaaaaa
attcaaaatccttttattgaccgaacaaattgggattgggaaattgaccctgaaggcctg
agaattgcacttcgtcgtatcacttctcgttatcgtattccagtgatgattacagaaaat
ggcttgggcgaatatgataaagttgaagatggaaaaattcatgatgattatcgaatcaaa
tatctagaaagtcatgttaaagcaatcaaagaagcgatgacggatggagcaaaagtcatt
ggttatcacacttggtcttatactgacctcctttcttggttaaatggctaccaaaaacgt
tatggctttgtctatgttgaccaagatgaaacaatggaaggttcattgaaacggataccg
aaggattcttattactggtatcaacatctcatcgaaacaaatgctgaagaagtctaa

DBGET integrated database retrieval system