KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_0322Help
Entry
uc509_0322        CDS       T02415                                 

Gene name
murA1
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lli00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    uc509_0322 (murA1)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    uc509_0322 (murA1)
Enzymes [BR:lli01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     uc509_0322 (murA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
319556..320821
Genome map
AA seq 421 aa AA seqDB search
MKKIVINGGKRISGTIPISGAKNSVVALIPATILANDIVTLEGVPDISDVASLVEIMEIT
GAKIERNLEEGRLVIDTRSVVSRPLPYGKINSLRASYYFNGALLGRFGQATVGLPGGCDL
GPRPTDLHDKAFKALGAKKIQEEEAEHLEVIGDSLVGTTIYMDVVSVGATINTMLAASRA
KGVTVIENAAREPEIIDVATLLNNMGAKVRGAGTDIIRITGIDEMHGAQHTVIPDRIEAG
TYLALAAAMGDGVIIENVIYEHLESFIAKLEEMGVRLTIREDSIEVHKSENLKSVNITSV
PYPGFATDLQQPITPLLLKAKGRGSIVDTIYQKRVNHVPELARMGANISVLDDRIIYDAP
NELTGSCVQATDLRAGAALVTAGIIASGTTKISNIEFILRGYDHIIEKLTAVGVDIQLIE
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagtaattaatggtgggaagcgtatctctggaacaattccaatttcagga
gcaaaaaattcagtggttgctttaattcctgcaaccattctagctaacgatattgttact
ctggaaggagttccagatatttctgatgtcgcaagtttagtcgaaattatggaaatcacg
ggagcaaaaattgagcgaaatcttgaagaaggtcgacttgtgattgatacacgtagtgtc
gtttcacgtcctctgccttatggaaagattaattctttgcgtgcttcttattattttaat
ggtgcacttttgggtcgttttggacaagcgacagttggcttgcctggaggctgtgattta
ggtcctcgtccaaccgatttacatgataaagcctttaaagctttaggggctaagaagatt
caagaagaagaagctgagcacttagaagtgattggtgattcattagttggaacaaccatt
tatatggacgttgtttccgttggagcaaccatcaatacgatgcttgctgctagtcgtgca
aaaggtgtaactgtaattgaaaatgctgcacgtgagcctgaaattattgatgtggcaacc
cttcttaataacatgggggcaaaagttcgtggtgcaggaacagatattatccgtatcact
gggatagatgaaatgcacggagctcaacatacggtaattcctgaccgaattgaggctgga
acttaccttgctttagctgctgcgatgggtgatggagttattattgaaaatgtcatctat
gaacatttggaatctttcattgctaaacttgaagaaatgggcgtacgtttgacgattcgt
gaagacagcattgaagttcataaatctgaaaatttaaaatcagttaatattacctctgtt
ccttacccaggatttgcgactgatttgcaacaaccaattacgccactgttgttaaaagca
aaaggtcgtggttcgattgttgatacgatttatcaaaaacgtgttaaccacgtacctgaa
ttagcgcgtatgggtgctaatatttctgttttggatgatagaattatttatgacgctccg
aatgagttaactggaagctgtgttcaagcaacagatttacgtgctggtgcggctctggtt
actgctggaattattgccagtggaactacaaaaatttctaatattgagtttatcctacga
ggctatgatcatatcattgaaaaattgactgctgttggtgtagatattcaattgattgaa
gagtga

DBGET integrated database retrieval system