KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_0358Help
Entry
uc509_0358        CDS       T02415                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lli00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    uc509_0358 (recR)
DNA repair and recombination proteins [BR:lli03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      uc509_0358 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
353288..353884
Genome map
AA seq 198 aa AA seqDB search
MYYPEPIARLIESFSKLPGIGQKTATRLAFYTIGMEDQDVNEFAKNLLSAKRDLRFCSIC
GNLTESDPCAICTDSTRDRTTILVVEESKDVLAMEKIREYRGLYHVLHGTISPMNGISPD
EINVKSLITRLMDSEVKEVIIATNATSDGEATAMYLARMIKPAGIKVTRLARGLAVGSDI
EYADEVTLSKAVENRLEI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtattatccagaacctattgctcgcctgattgagtcattttcaaaattacccggaatt
gggcagaaaacggcgacacggctagctttttatacgattggcatggaagatcaagatgtc
aatgaatttgcgaaaaatctcttgtcagcaaaacgagatttacgcttttgctctatttgt
gggaatttaacagaaagtgatccttgtgctatttgtactgattccacacgtgatagaaca
acgatattggttgtcgaagaatctaaagatgttcttgccatggaaaaaatccgcgaatat
cgtggactctatcatgtcttacatggaacaattagtccaatgaacggaatctctcctgat
gaaattaatgttaaatctttgattacaaggttaatggactcagaagttaaagaagtgatt
attgcgaccaatgcgacatcggatggtgaagcaaccgctatgtatctggctcgaatgatt
aaacctgcgggaattaaagtgacacgactggctcgtggattagctgtagggtctgatata
gaatacgctgatgaggttaccttatcaaaagccgtggagaatcggttggaaatttga

DBGET integrated database retrieval system