KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_0521Help
Entry
uc509_0521        CDS       T02415                                 

Gene name
nagZ
Definition
Glycoside hydrolase, family 3 (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lli00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:lli00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
513668..514879
Genome map
AA seq 403 aa AA seqDB search
MTKRLKKQAKPVVFLGIVIGCALIVSGVLGLSGHLNNQEAIKSKKKNQVSETKTNSSSQN
KSDQKMPKMTLEQKVGQLFMTGMPANNYDQATFDAIEKYQVGSIILTGRSNLSIPEMKVI
TDKLQGLAPANRRLLISCDQEGGNVQVLQGTGFSEMPNGLIQGSWAPEKLQEEAKNWGSE
LSTAGINFDLAPVADQVLSADFAPQNAPIGYWSRQYAYDKANIVSHADAFSKGMKSAGVL
TTAKHFPGLGAVTGNTDISAGVRDSQTNPKSESVQIFKELISSGVPSIMTATAIYDQIDP
ELPGAFSPKMVDGLLRNQLGFDGLVITDDLSNAVQVQAWSPGQRAVLALAAGNDLVLANE
PTQIPEMISEVLQKAKSDQGFAEKINQASSRVMKVKEQMKLVE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaaagattaaagaagcaagcaaaaccagtcgtttttctaggcattgttattggt
tgtgcacttattgtgtcaggagttcttggtctgtcaggacatttaaataatcaagaagca
atcaaaagtaaaaagaaaaatcaagtttcagaaacaaaaactaattcaagtagtcaaaat
aaaagtgaccaaaaaatgccaaaaatgactttagaacaaaaagtgggtcagttatttatg
acggggatgcctgcaaataactatgaccaagcaacttttgatgcgattgaaaaatatcag
gttgggagtatcattttgacgggccgctctaatctcagtattcctgaaatgaaagttatt
actgacaagctacaaggcttagcaccagctaatcgacgtcttttgatttcttgtgatcaa
gagggaggaaacgttcaggttcttcaagggactggtttttcagaaatgcctaatggattg
attcaaggaagttgggcgccagaaaaattacaagaagaagctaaaaattgggggagtgaa
ctttcaaccgctggaatcaattttgatttagccccagttgctgaccaggttttatctgct
gattttgcaccacaaaatgctccgattggctactggagtcgtcagtatgcttatgacaaa
gctaatattgtcagccatgccgatgctttttctaaaggaatgaaatcagctggtgtttta
acaaccgctaagcattttccagggcttggagcggtgacaggtaacacggatatcagtgct
ggcgtcagagatagtcaaacaaatcctaaaagtgaatccgttcagatttttaaagaatta
atttcttcgggagttccatcaattatgacggcgacagcaatttatgatcaaattgaccct
gagcttccgggagccttctcacctaaaatggttgatggcttactccgaaatcaattaggc
tttgatggtttggtaattactgacgatttatcaaacgctgttcaagttcaagcttggtca
ccaggccaaagagcagtattggcgctggcagcgggaaatgaccttgtcctagccaatgag
cccactcaaattccagaaatgatttcagaagttttgcaaaaagcaaaatctgatcaggga
tttgcagaaaaaattaatcaagcatcatcaagggtgatgaaagtaaaagaacaaatgaaa
cttgtagaatag

DBGET integrated database retrieval system