KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_0548Help
Entry
uc509_0548        CDS       T02415                                 

Gene name
murA1
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lli00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lli00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
535332..536612
Genome map
AA seq 426 aa AA seqDB search
MDKIIVKGGQTKLQGEVEIEGAKNAVLPLLAATLLASEGEVVLTNVPILSDVFMMNNLVD
HLGTSISFDQEAKKIIAKANSEIKTTAPYEYVSKMRASIVVMGPILARNGQARVSMPGGC
SIGSRPIDLHLRGFEQMGATITQNAGYIEAKADKLKGAHIYLDFPSVGATQNLILAATLA
EGVTTLENAAREPEIVDLANLLNKMGANVKGAGTDTIIIKGVEKMHGAKHSVVQDRIEAG
TFMVAAAMTQGDVLIKDAIAEHNRPLISKLSEMGVNFTQEETGLRVVGPEKLKATSVKTL
PHPGFPTDMQSQMAAAQAISAGESVMVETVFENRFQHLEEMRRMGLEVDITRNTALIQGN
SNLQGAAVKSTDLRASAALILLGLVAKGQTTVRRLSHLDRGYYKFHEKLKALGADIVRVK
DEYGEE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggataaaataattgtaaaaggtgggcaaacaaaacttcaaggagaagtcgaaattgaa
ggagcaaaaaatgctgttcttccacttcttgctgctactttacttgcgagtgaaggcgaa
gttgtattaactaatgtccctattttaagtgatgtttttatgatgaataatttagtagat
catctagggacgagcattagttttgatcaagaagcaaagaaaatcattgctaaagccaat
tctgaaataaaaacaactgccccttatgagtatgtcagcaaaatgcgagcatctattgtt
gtcatgggaccgattttagctagaaatggccaagcgcgggtttctatgccaggaggatgt
tcaattggttcacgtccaatcgatttacatttgcgtggatttgagcaaatgggagcaaca
attactcaaaatgctggttatattgaagctaaggctgataaattaaaaggagctcacata
tatcttgatttcccttcagtaggagccacgcaaaatctaattcttgcggctaccttagcc
gaaggagtaacaacactcgaaaatgcggcccgcgaaccagaaatcgttgacttagccaat
cttttgaacaaaatgggtgcaaatgttaagggcgctgggactgatacaatcataatcaaa
ggtgttgaaaaaatgcatggtgcaaaacactctgttgttcaagatcgaattgaagccgga
actttcatggttgcagcagcaatgacccaaggtgatgtactaattaaagatgcaattgct
gagcataatcgtccattaatatcaaaactcagtgaaatgggagttaatttcactcaagaa
gaaacaggacttagagtcgtagggcctgaaaaactcaaagctactagtgttaaaacattg
ccacacccaggttttccaactgatatgcaatctcaaatggccgccgctcaagcgatctcg
gctggagaatctgtaatggtcgaaacagtatttgaaaatcggttccaacatttagaagaa
atgcgtcgtatgggattggaagtagatattactagaaatacagccttaatccaaggaaat
tcaaatttgcaaggagccgcagtaaaatcaacagatttaagagcgagtgcagctttgatt
cttttaggattagtggctaaaggccaaacaactgtaagaagattaagccacttagaccgc
ggttattataaattccatgaaaaattaaaagcacttggtgctgatattgtccgagtgaaa
gatgaatacggagaagaataa

DBGET integrated database retrieval system