KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_1217Help
Entry
uc509_1217        CDS       T02415                                 

Gene name
hisD
Definition
Histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lli01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:lli00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1205154..1206461
Genome map
AA seq 435 aa AA seqDB search
MLKQIDYQGSLEEVANKFQGRKAEVSEEVNKSVQEIVKAIRKEGDSAIFSYAKKFDGYNA
DKNNLLVTRKEREEGLEKIDENYFRILRRTKSQIEEFHKHQLGNSWSIYKENGVIMGQIA
RPLERVALYVPGGTAAYPSTVIMNAVPALLAGVKEIIMITPVKADGQVNTNILAAAEVCG
IETIYKVGGAQAVAAVAYGTESIPKVDKIVGPGNIFVATAKKICYGMVDIDMIAGPSEVL
VIADEKANPKYIAADLMAQAEHDKLASAILVTTSESLVQKVDEELEKQVQSLERGEIIES
SVSNYGGAIVVKSIDEAFEVSNQLAPEHLEVLTTDPLAQLPKIKNDGSIFLGEYTPEPLG
DYMSGSNHVLPTGGTAKFYSGLGVYNFVKYSTYSYYPKEILADFKEDVVTFAKSEGMSAH
ANSISVRFDDEKKEK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaacaaattgattatcaaggaagtcttgaagaagttgcaaataaatttcaagga
cgaaaagccgaagtttcagaagaagtaaataaaagtgttcaagaaattgtcaaagctatt
cgtaaagagggtgattctgctatatttagctatgcaaaaaagtttgatggatataatgct
gacaaaaataatttacttgtcacgcgcaaggaacgagaagagggcttagaaaaaattgat
gaaaattactttagaattctgcgtcgtaccaaatcacaaattgaagaattccacaagcat
caattaggaaattcatggagcatttataaagaaaatggggttatcatgggtcaaattgca
cgtcctttagaacgtgtcgccctttacgttccaggtggcacagcagcctatccttcaaca
gttattatgaacgcagtgcccgcacttttagcaggggttaaagaaattattatgattaca
ccagttaaggctgacggacaagtgaatacaaatattttagccgccgccgaagtttgtggg
attgaaacaatctataaagtcggtggcgctcaagctgtggccgccgttgcttacgggaca
gagtctattcctaaagttgataagattgtcggacccggaaatatttttgtagccacggcc
aagaaaatttgttacggtatggttgatattgatatgattgcaggaccgtcagaagttttg
gtcattgctgacgaaaaagcaaatccaaaatatatcgctgctgatttaatggcgcaagcc
gaacatgataaacttgcgtcagcaattttagtgacaacttctgaaagtcttgttcaaaaa
gtagatgaagaattagaaaaacaagttcaaagtttagaacgtggtgaaattattgaaagt
tctgtcagtaattatggcggtgccattgttgtcaaatctattgacgaagctttcgaggtt
tctaatcaattggctccagagcatttagaagttttgactactgaccctttagcccaactt
ccaaaaatcaaaaatgatggttcaatctttcttggagaatatacgccagaaccattgggc
gactatatgtcaggaagtaatcatgtcttacctactggcggaacggccaagttttactct
ggcttaggcgtctacaattttgttaaatattcaacttatagttattatcctaaagaaatt
ttggcggatttcaaagaagatgttgtaacttttgctaaatcagaaggaatgagtgctcat
gccaattcaatttctgtgagatttgatgatgaaaaaaaggagaaataa

DBGET integrated database retrieval system