KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_1353Help
Entry
uc509_1353        CDS       T02415                                 

Gene name
galU
Definition
UDP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:lli00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lli00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lli00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lli00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1347136..1348077
Genome map
AA seq 313 aa AA seqDB search
MKQTTIPNKARKVRKAVIPAAGLGTRFLPATKAIAKEMLPIVDKPTIQFIVEEALKSGIE
DILIVTGKAKRPIEDHFDSNIELEQNLLEKGKTELLKLVEETTDINLHFIRQSHPKGLGH
AVLQAKAFVGNEPFVVMLGDDLMNITGNETPLTKDLINDYEKTHASTIAVMKVPHEDVDK
YGVIDPNGEVSKGLYNVERFVEKPKVEEAPSDLAIIGRYLLTPEIFDVLETQVPGAGNEI
QLTDAIERLNKTQRVFAHEFTGKRYDVGDKLGFVETTIEYGLEHPQIGDNLRNYIIEKAK
ELSKDEPKQNTKK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaactactatacctaacaaagccagaaaagttcgtaaagctgttattcctgct
gctggtcttggaactcgctttttaccagcaactaaagccattgccaaagaaatgttgcca
attgttgataaacctactatccaattcatcgttgaagaagctttgaaatctggaatcgaa
gacattttgattgtaactggtaaagccaaacgtccaattgaagaccattttgactcaaat
attgagcttgaacaaaatttgcttgaaaaaggaaaaacagaattacttaaacttgtagaa
gaaacaacagatatcaatcttcattttatccgccaatctcatccaaaaggtttgggacac
gctgttcttcaagccaaagcttttgttggcaacgaaccttttgtagttatgcttggtgat
gatttgatgaatatcacaggcaatgaaactcctttgactaaagacttgattaatgattat
gaaaaaactcatgcttcaacaatcgctgtaatgaaagtgcctcatgaagatgttgacaaa
tacggagtaatcgacccaaatggtgaagtttctaaaggtctttacaatgttgaacgtttt
gttgaaaaaccaaaagttgaggaagctccttcagaccttgcaattatcggtcgttacctc
ttgactccagaaatttttgatgttttagaaacacaagtacctggtgctggaaatgaaatt
caattaactgatgcgattgaacgtttgaataaaacacaacgtgtctttgctcatgaattt
actggaaaacgttatgatgttggtgataaacttggttttgtggaaacaacaatcgagtat
ggtttagaacacccacaaatcggtgacaatttgagaaattatatcatcgaaaaagctaaa
gaactttctaaagatgaaccaaaacaaaatacaaaaaaataa

DBGET integrated database retrieval system