KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_1418Help
Entry
uc509_1418        CDS       T02415                                 

Definition
Beta-glucosidase/6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lli00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1410978..1412393)
Genome map
AA seq 471 aa AA seqDB search
MEEILTTLKYTLQVNFIDGKGLSVADAMPGGKERLAILASPEFDWTIDTEHFTYPNHDGI
DHYHHFKEDIALFAEMGFKAYRFSVAWSRIFPKGDETTPNEKGLLFYDQLIDECLKYRIE
PVITISHYEMPLNLAKSYGGWKNRELIEFYVRFAKVLLERYQDKVKYWMTFNEINSATFF
SGLSQGLVPSNDGDDKTNVFKAWHNQFVTSAQAVKFGHDLNKNLKIGCMSIYSTTYSFDA
NPVNQLATQESIQEFNYFCNDVQVRGAYPAFTNRLHRKHGVNSEVLEISEEDLKIIAEVT
VDYIGFSYYMSTVESKTGEGVQASGNMVLGGVKNPFLKESEWGWAVDPDGLRYALNDLYG
RYQIPLFIVENGLGAIDKVEEDGTIQDDYRIDYLKKHIQSMSEAVEDGVELMGYTPWGCI
DLVSASTGEMSKRYGFIYVDLDDSGNGTNKRFKKKSFDWYKQVIDSNGTNL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaatattaacaactctaaagtatactttacaagtaaactttatagatggtaaa
gggctctcagtagcagatgcaatgccaggaggtaaagaaagattggcaattcttgcaagt
ccggaatttgattggacgattgatactgaacattttacttatccaaatcatgatggaatt
gatcattatcatcattttaaagaagacattgcattatttgcggaaatgggttttaaagcg
tatcgtttttcagtagcttggtcaagaatttttccaaagggagatgaaacaactcccaat
gaaaaaggtttgcttttttatgatcaactgattgatgagtgtttgaaatatagaattgaa
ccagtgattacaatttctcactatgaaatgccacttaatttggctaaatcatatggagga
tggaaaaatcgtgaacttatcgaattttatgtgcggtttgcaaaagtccttttagaacgc
tatcaagacaaagtaaaatattggatgacgtttaatgaaattaactcggcgactttcttt
tcaggattaagtcaaggacttgttccatctaatgatggagatgataaaactaatgtattt
aaagcttggcataatcagttcgttacaagtgctcaagcagttaaatttggtcatgatttg
aataaaaatttgaaaattggttgcatgagcatttattcaacaacttattcctttgatgct
aatccagtcaatcaattggcgacacaagaaagtattcaagaatttaattatttttgtaat
gatgtacaagttcgcggagcctaccctgcgtttacaaatagacttcatcggaaacatgga
gtaaattcagaagtccttgaaatttctgaagaagatcttaagataatcgcagaagtaaca
gttgactatatagggtttagttattacatgtcgacggttgaatcaaaaacgggagaaggc
gtccaagcttcagggaatatggttcttggcggagtaaaaaatcctttcttaaaagaaagt
gaatggggttgggcagttgatcctgatggtcttcggtatgctctcaatgatttgtacgga
cgctatcaaattcctctcttcattgttgaaaatggtttgggggcaattgataaagttgaa
gaagacggaactattcaagatgattatcggattgactatctcaaaaaacatattcaatca
atgagtgaagcagttgaagatggtgttgaactaatgggttatacaccttggggctgtatt
gacttagtttctgcatcaacaggggagatgagtaaacgttatggttttatctatgttgac
ttagatgatagcggaaatggaacgaataaaagatttaagaaaaaatcgttcgattggtat
aaacaagtaattgattctaacggtacgaatttataa

DBGET integrated database retrieval system