KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_1456Help
Entry
uc509_1456        CDS       T02415                                 

Gene name
xylA
Definition
Xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:lli00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lli00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1447043..1448368)
Genome map
AA seq 441 aa AA seqDB search
MDYFNDIAPIKYEGTKTKNMFAFRHYNPEEVVAGKTMEEQLHFALAFWHTITMDGADPFG
SATMERPWDLEGGSELDRAHRRVDAFFEIAEKLGVKYYCFHDIDIAPKGNSLKEFYANLD
EITDHLLEKQKETETGIKLLWNTANMFSNPRYMNGVSTSNRAEVFAYGAAQVKKGLELSK
KLGGENYVFWGGREGYESLLNTDMGLEMDHMAKFFHLAIDYAKSINHLPIFLIEPKPKEP
MTHQYDFDAATALAFLQKYDLDKYFKLNLETNHAWLAGHTFEHELNTARTFGALGSIDAN
QGNYLLGWDTDEFPTLVIDITLAMHQILLNGGLGKGGINFDAKVRRTSFKAEDLILAHIA
GMDTYARALKGAAAIIEDKFLSDIVEERYSSYKKTEVGQSIENGTATFESLAAYALEHGD
DIELDSNHLEYIKSVLNDYLV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggattactttaacgacatcgcacctatcaaatacgaaggtacaaaaactaaaaacatg
tttgccttccgccattataacccagaagaagtggttgctgggaaaacaatggaagaacag
cttcatttcgcccttgctttttggcatacaattacgatggacggggctgacccatttggt
agtgccacaatggaacgtccttgggacttggaaggtggctctgaacttgaccgtgctcat
cgtcgagtagatgctttctttgaaattgccgaaaaattgggtgttaaatattattgtttc
catgatattgacatcgcgcctaaaggaaattctttgaaagaattttatgcaaacttagat
gaaattactgaccatcttcttgaaaaacaaaaagaaacagaaacaggcattaaactcctc
tggaatacggcaaatatgttctcaaacccacgttatatgaatggggtttcgacatcaaat
cgtgctgaagtttttgcttatggtgctgctcaagtcaaaaaaggacttgaactttctaaa
aaacttggtggtgaaaactatgtattctggggtggtcgtgaaggttacgaatcacttttg
aacacagacatgggtcttgaaatggatcacatggcaaaattcttccatttggcgattgat
tatgcaaaatcaattaaccatttgccaatcttcttgattgaaccaaaaccaaaagaacca
atgactcaccaatacgactttgatgcagcgacagctcttgctttcttgcaaaaatatgat
ttggacaaatatttcaaactcaatcttgaaacaaaccatgcttggttggctggtcatact
tttgaacacgaattaaatactgcacgtacttttggtgccttaggttcaatcgatgccaat
caaggaaattatttgctcggctgggatactgatgaatttccaacacttgtcattgatatc
acgcttgctatgcaccaaattcttttgaacggtggacttggtaaaggtggaattaacttt
gatgccaaagttcgtcgtacaagcttcaaagccgaagatttgattttggctcatattgca
gggatggatacttatgcacgtgcgcttaaaggtgcagcagccatcattgaagacaaattc
ttgtctgatatcgttgaagaacgttatagttcatacaagaagacagaagttggtcaatct
atcgaaaatggaacagcaacttttgaaagtcttgctgcttatgctcttgagcatggggat
gacatcgaacttgattctaaccacttagaatatatcaaatcagtattgaatgactatctt
gtttaa

DBGET integrated database retrieval system