KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_1521Help
Entry
uc509_1521        CDS       T02415                                 

Definition
putative lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:lli00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    uc509_1521
Enzymes [BR:lli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     uc509_1521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1508815..1509660)
Genome map
AA seq 281 aa AA seqDB search
MKKQYEIISMKDHYRIRLGIFEPQEKAKGVVQLVHGFGEYTGHYLYLINELVNAGFVCFM
HDQRGHGVLAAAKPKLQGRARNYENFISDVLEVRKIIGKRYPKLPVYLFGHSMGGNISLN
VLLRNVENQKLYQKAVIESPWLALTNPPAIPLQKLAQVLGKFNSKIRVRTGLKVDAISHR
SDLVDLVTKDGIYHELLSLRLFSQIMEAGRFAQSQAEQLKIPTLLFCGEEDQICSPLAIR
SFAENAGANLELVEVAEGYHALHLDTKADAFIDKMKAFLLE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacagtatgaaattatttcaatgaaagatcactatcggattcgtcttggaatt
tttgaaccacaagaaaaagcaaaaggcgtggtgcaattagttcatggttttggcgaatat
acgggtcattatttatatttaatcaatgaattagttaatgctggttttgtttgctttatg
cacgaccaaagaggacatggggttctagcagcagctaaacctaaacttcaaggacgagca
agaaattatgaaaactttattagtgatgtcttagaagtccgaaaaataattggcaaaaga
tatcccaaattaccagtttatctcttcggacacagtatgggaggaaatatttcactgaat
gttctgctgagaaatgttgaaaatcaaaaactttatcaaaaagcagttattgaatctcct
tggcttgccttgacaaatccaccggctattcccctacaaaagttggctcaagttttaggg
aaatttaattcaaaaattagagttcgtacgggacttaaagttgatgcaatctctcatcgg
agtgacttagttgatttagtgactaaagatggaatatatcatgaactattatctttacgt
ttgttttcacaaattatggaagcaggacgttttgcccaaagtcaggccgagcagttaaag
ataccgaccttattattttgtggagaagaagaccaaatttgttcaccgttagcgattcgt
tcctttgctgaaaatgctggtgctaatttggaattagttgaagttgctgagggctatcat
gcccttcatttagatactaaagcagatgcttttattgacaaaatgaaggctttcctgctt
gaataa

DBGET integrated database retrieval system